Property Summary

NCBI Gene PubMed Count 23
PubMed Score 14.48
PubTator Score 18.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.0e-05
Multiple myeloma 1332 1.5e-03
primary pancreatic ductal adenocarcinoma 1109 5.9e-03
Disease Target Count Z-score Confidence
Bone cancer 16 0.0 3.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 2 23 4.404 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.442 1.5e-03
ovarian cancer -1.400 3.0e-05
primary pancreatic ductal adenocarcinoma 1.128 5.9e-03

Gene RIF (5)

AA Sequence

MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV      1 - 70
VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ         71 - 136
//

Text Mined References (30)

PMID Year Title