Property Summary

NCBI Gene PubMed Count 23
PubMed Score 14.50
PubTator Score 18.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.442 0.001
primary pancreatic ductal adenocarcinoma 1.128 0.006
ovarian cancer -1.400 0.000

Synonym

Accession P37108 B5BUF5 Q6B0K5 Q96Q14 SRP14
Symbols ALURBP

Gene

PDB

1E8O   1E8S   1RY1   4UYJ   4UYK   5AOX  

Gene RIF (5)

PMID Text
25697503 Dats show that Alu RNA promotes functional binding of Signal Recognition Particle proteins SRP9/14 to 40S ribosomal subunits.
25010285 Interaction of HIV-1 Gag with signal recognition particle 14kDa (SRP14, homologous Alu RNA binding protein) is identified in a series of six affinity purification/mass spectrometry screens
23166591 Interaction of HIV-1 Gag with signal recognition particle 14kDa (SRP14, homologous Alu RNA binding protein) is identified in a series of six affinity purification/mass spectrometry screens
20348448 mutational study on SRP9/14 that identified and characterized regions and single residues essential for elongation arrest activity
18455985 SRP14 mutant proteins with absence of a peptide elongation delay caused inefficient targeting of preproteins leading to defects in secretion, depletion of proteins in the endogenous membranes, and reduced cell growth.

AA Sequence

MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV      1 - 70
VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ         71 - 136
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25697503 2015 Alu RNA regulates the cellular pool of active ribosomes by targeted delivery of SRP9/14 to 40S subunits.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...