Property Summary

NCBI Gene PubMed Count 158
Grant Count 11
R01 Count 5
Funding $559,547.57
PubMed Score 47.29
PubTator Score 130.57

Knowledge Summary

Patent (3,641)

Expression

Gene RIF (128)

PMID Text
27045669 These results indicate that ENaC functions as a sensor for external Cd2+.
26611714 The rs4149570 and rs7956915 polymorphisms of SCNN1A might play important roles in the susceptibility to respiratory distress syndrome, particularly in term infants.
26032502 ASIC1A and ENaCalpha form functional heterotrimers acting as ion channels.
25900089 Four nonsynonymous amino acid variants in SCNN1A in nonwhite Cystic fibrosis patients with non-diagnostic CFTR genotypes was identified.
25559464 The transcriptional expression of alpha, beta, and gamma subunits of ENaC was elevated in nasal polyp compared to nasal mucosa
25517724 The long isoform of alphaENaC forms the structural basis of a channel with different activity and regulation, which may not be easily distinguishable in native tissue, but may underlie sodium hyperabsorption and salt sensitive differences in humans.
25371970 Skin hydration status regulates sodium homeostasis and inflammatory pathways through the epithelial sodium channel (ENaC).
25339316 Five de novo mutations were identified in four genes (SCNN1A, KCNJ16, KCNB2, and KCNT1) in three Brugada syndrome patients
25242083 It essentially participates in regulatory systems of blood pressure and normal gas exchange.
25187622 ENaC regulates miR-101/miR-199a-3p during embryo implantation with the involvement of CREB phosphorylation.
More...

AA Sequence

MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFEFFCNNTTIHG      1 - 70
AIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRY     71 - 140
PEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSL    141 - 210
RDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIF    211 - 280
ACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGAR    281 - 350
VMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSC    351 - 420
FQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGY    421 - 490
SRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFG    491 - 560
SSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPG    561 - 630
PAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP                                   631 - 669
//

Text Mined References (167)

PMID Year Title
27045669 2016 Effects of Cd2+ on the epithelial Na+ channel (ENaC) investigated by experimental and modeling studies.
26772908 2016 Epithelial sodium channel (ENaC) family: Phylogeny, structure-function, tissue distribution, and associated inherited diseases.
26611714 2015 Association of SCNN1A Single Nucleotide Polymorphisms with neonatal respiratory distress syndrome.
26032502 2015 Atomic force microscopy imaging reveals the formation of ASIC/ENaC cross-clade ion channels.
25900089 2016 Assessment of epithelial sodium channel variants in nonwhite cystic fibrosis patients with non-diagnostic CFTR genotypes.
25559464 2015 Expression and distribution of epithelial sodium channel in nasal polyp and nasal mucosa.
25517724 2015 A long isoform of the epithelial sodium channel alpha subunit forms a highly active channel.
25371970 2015 Hydration status regulates sodium flux and inflammatory pathways through epithelial sodium channel (ENaC) in the skin.
25339316 2014 Disease-targeted sequencing of ion channel genes identifies de novo mutations in patients with non-familial Brugada syndrome.
25242083 2014 Characteristics and pharmacological regulation of epithelial Na+ channel (ENaC) and epithelial Na+ transport.
More...