Property Summary

NCBI Gene PubMed Count 168
PubMed Score 63.21
PubTator Score 130.57

Knowledge Summary

Patent (3,641)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Kidney disease 411 3.489 1.7

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -3.569 7.1e-16
adult high grade glioma -1.300 1.3e-03
aldosterone-producing adenoma -1.518 4.3e-02
Endometriosis -1.087 3.7e-02
glioblastoma -1.300 1.1e-04
interstitial cystitis -3.000 5.6e-03
intraductal papillary-mucinous adenoma (... 1.400 9.0e-04
intraductal papillary-mucinous carcinoma... 1.900 2.3e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.9e-03
lung cancer -1.600 6.0e-04
nasopharyngeal carcinoma -1.900 3.0e-04
nephrosclerosis -1.582 2.1e-02
non primary Sjogren syndrome sicca 1.100 2.4e-02
osteosarcoma 1.172 4.6e-05
ovarian cancer 2.700 7.3e-04
pancreatic cancer 1.300 1.9e-03
pancreatic ductal adenocarcinoma liver m... 2.592 1.5e-02
pituitary cancer -3.800 9.5e-07
spina bifida -2.164 3.9e-02

Protein-protein Interaction (2)

Gene RIF (137)

AA Sequence

MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFEFFCNNTTIHG      1 - 70
AIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRY     71 - 140
PEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSL    141 - 210
RDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIF    211 - 280
ACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGAR    281 - 350
VMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSC    351 - 420
FQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGY    421 - 490
SRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFG    491 - 560
SSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPG    561 - 630
PAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP                                   631 - 669
//

Text Mined References (177)

PMID Year Title