Property Summary

NCBI Gene PubMed Count 75
Grant Count 36
R01 Count 13
Funding $1,665,986.96
PubMed Score 76.77
PubTator Score 94.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
esophageal adenocarcinoma 2.100 0.046
psoriasis 2.000 0.002
atypical teratoid / rhabdoid tumor 2.100 0.023
medulloblastoma, large-cell 1.600 0.008
primary pancreatic ductal adenocarcinoma 1.160 0.024
colon cancer -3.100 0.013
active Crohn's disease -2.847 0.003
pancreatic cancer 1.200 0.042
breast carcinoma -1.100 0.013
cystic fibrosis -1.600 0.000
Breast cancer -1.800 0.000
ulcerative colitis -2.800 0.000
ovarian cancer -2.400 0.000

Gene RIF (57)

PMID Text
26323233 Our findings suggested that CYP19A1 and HSD17B2 polymorphisms might be associated with circulating sex hormone levels in Japanese postmenopausal women, independent of current BMI.
26228249 ATRA treatment decreased the mRNA expression of 17-beta-dehydrogenase 2 (HSD17B2) which converts estradiol into estrone in a dose-dependent manner
26194504 In both arm and subumbilical skin biopsy of patients with idiopathic hirsutism, there was an up-regulation of HSD17B2 mRNA expression.
26123590 Data indicate that conversion of testosterone to 4-dione detected in abdominal adipose tissue is caused by 17b-HSD type 2 which is localized in the vasculature of the adipose compartment.
25929810 High expression of either HSD17B2 or HMGCS2 predicted poor susceptibility of rectal cancer to preoperative chemoradiotherapy.
25776474 This study demonstrated that HSD17B2 transcript and protein levels are linked to some clinicopathological features in gastric cancer.
24938708 overexpression of 17beta-HSD2 in sebocytes significantly increased the androstenedione production and markedly decreased the amounts of testosterone and dihydrotestosterone
24682418 This study identified specific germline variations in estradiol metabolism-related pathways, namely CYP1B1, SULT2B1, and HSD17B2, as novel prognostic markers that are cumulatively associated with increased risk of prostate cancer progression
24563232 Single nucleotide polymorphism in HSD17B2 gene is associated with hepatocellular carcinoma.
24560990 SNP variants in the 17beta-HSD2 and 17beta-HSD7 genes and 17beta-HSD7 copy number is associated with increased estradiol levels in breast cancer tissues.
More...

AA Sequence

MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT      1 - 70
YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT     71 - 140
KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS    141 - 210
KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE    211 - 280
KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL    281 - 350
AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT                                     351 - 387
//

Text Mined References (78)

PMID Year Title
26323233 2015 Polymorphisms in CYP19A1, HSD17B1 and HSD17B2 genes and serum sex hormone level among postmenopausal Japanese women.
26228249 2015 Retinoic acid has the potential to suppress endometriosis development.
26194504 2015 Is idiopathic hirsutism (IH) really idiopathic? mRNA expressions of skin steroidogenic enzymes in women with IH.
26123590 2015 Oxidative activity of 17?-hydroxysteroid dehydrogenase on testosterone in male abdominal adipose tissues and cellular localization of 17?-HSD type 2.
25929810 2015 The prognostic impact of lipid biosynthesis-associated markers, HSD17B2 and HMGCS2, in rectal cancer treated with neoadjuvant concurrent chemoradiotherapy.
25776474 2015 Expression of 17?-hydroxysteroid dehydrogenase type 2 is associated with some clinicopathological features in gastric cancer.
24938708 2014 Expression of steroidogenic enzymes in human sebaceous glands.
24682418 2014 Steroidogenic germline polymorphism predictors of prostate cancer progression in the estradiol pathway.
24563232 2014 Association of genetic polymorphisms in HSD17B1, HSD17B2 and SHBG genes with hepatocellular carcinoma risk.
24560990 2014 Effects of SNP variants in the 17?-HSD2 and 17?-HSD7 genes and 17?-HSD7 copy number on gene transcript and estradiol levels in breast cancer tissue.
More...