Property Summary

Ligand Count 285
NCBI Gene PubMed Count 75
PubMed Score 78.77
PubTator Score 94.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease -2.847 2.9e-03
atypical teratoid / rhabdoid tumor 2.100 2.3e-02
Breast cancer -1.800 4.3e-05
breast carcinoma -1.100 1.3e-02
colon cancer -3.100 1.3e-02
cystic fibrosis -1.100 2.6e-03
esophageal adenocarcinoma 2.100 4.6e-02
malignant mesothelioma 1.600 1.4e-05
medulloblastoma, large-cell 1.600 8.2e-03
ovarian cancer -2.400 7.8e-15
pancreatic cancer 1.200 4.2e-02
primary pancreatic ductal adenocarcinoma 1.160 2.4e-02
psoriasis 2.000 2.0e-03
ulcerative colitis -2.800 3.9e-06

Protein-protein Interaction (1)

Gene RIF (57)

AA Sequence

MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT      1 - 70
YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT     71 - 140
KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS    141 - 210
KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE    211 - 280
KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL    281 - 350
AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT                                     351 - 387
//

Text Mined References (78)

PMID Year Title