Property Summary

Ligand Count 150
NCBI Gene PubMed Count 51
PubMed Score 102.21
PubTator Score 61.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Alzheimer's disease -1.100 4.6e-02
Pick disease -1.400 8.2e-05
progressive supranuclear palsy -1.300 8.5e-03
psoriasis -1.100 8.0e-04

Protein-protein Interaction (8)

Gene RIF (36)

AA Sequence

MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAK      1 - 70
RGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLP     71 - 140
SHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSK    141 - 210
ALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSL    211 - 280
IPAWAFYSGAFQRLLLTHYVAYLKLNTKVR                                            281 - 310
//

Text Mined References (52)

PMID Year Title