Property Summary

Ligand Count 47
NCBI Gene PubMed Count 144
PubMed Score 969.84
PubTator Score 256.64

Knowledge Summary

Patent (38,459)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Primary pulmonary hypertension 14 0.0 5.0

Expression

  Differential Expression (10)

Disease log2 FC p
breast carcinoma -1.300 1.1e-04
intraductal papillary-mucinous adenoma (... -1.600 7.4e-04
intraductal papillary-mucinous carcinoma... -1.200 1.4e-02
intraductal papillary-mucinous neoplasm ... -1.700 6.7e-03
invasive ductal carcinoma -1.200 7.6e-03
lung adenocarcinoma -1.800 3.2e-21
lung carcinoma -2.200 5.0e-17
non-small cell lung cancer -1.511 2.6e-29
osteosarcoma -1.968 1.8e-04
psoriasis -1.100 3.6e-04

Protein-protein Interaction (2)

Gene RIF (120)

AA Sequence

MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCG      1 - 70
NLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGL     71 - 140
WHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGK    141 - 210
GRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYH    211 - 280
EHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLG    281 - 350
LAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED    351 - 420
YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQ    421 - 490
KISNSPEKPKVIQ                                                             491 - 503
//

Text Mined References (143)

PMID Year Title