Property Summary

NCBI Gene PubMed Count 91
Grant Count 99
R01 Count 32
Funding $11,241,036.76
PubMed Score 588.29
PubTator Score 199.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.208 0.007
primary pancreatic ductal adenocarcinoma 1.044 0.019
ductal carcinoma in situ -1.100 0.003
ovarian cancer 1.500 0.000

Synonym

Accession P36969 O43381 Q6PJ59 Q9UPK2 PHGPx
Symbols MCSP
SMDS
GPx-4
PHGPx
snGPx
GSHPx-4
snPHGPx

Gene

PANTHER Protein Class (2)

PDB

2GS3   2OBI  

Gene RIF (80)

PMID Text
26708178 use GPX4 and GPX7 as possible markers for improving HCC diagnosis/prognosis.
26112936 GPX1, GPX3, and GPX4 genes may play a role in clear cell renal cell carcinoma cancerogenesis.
25884073 polymorphism of gene of glutathione peroxidase predisposes to more severe affection of liver and progression of chronic hepatitis C.
25851338 One SNP (rs3746162) in GPX4 was significantly associated with bladder cancer recurrence after transurethral resection.
25574043 GPx4 is essential for maintaining oxidative homeostasis and keeping defense against oxidative stress in conjunctival epithelial cells.
25516417 Hepatitis C virus (HCV) induces oxidative stress but controls it tightly by inducing ROS scavengers. Among these, GPx4 plays an essential role in the HCV life cycle.
24706940 Identification of truncating mutations in GPX4 in two families affected with Sedaghatian-type spondylometaphyseal dysplasia.
24191733 A membrane glycoprotein GPX4 was shown to play a significant role in gamete interactions.
24039907 Erythrocyte glutathione peroxidase activity is modified by single nucleotide polymorphisms in SEPP1, GPX4 and GPX1 and by estrogens.
23934705 GPX4c718t SNP is functional and that variants of this SNP can have detrimental consequences on endothelial function leading to a greater risk of vascular disease.
More...

AA Sequence

MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVA      1 - 70
SQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDA     71 - 140
HPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF                 141 - 197
//

Text Mined References (94)

PMID Year Title
26708178 2015 GPX4 and GPX7 over-expression in human hepatocellular carcinoma tissues.
26112936 2015 Aberrant expression of selenium-containing glutathione peroxidases in clear cell renal cell carcinomas.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25884073 2014 [The relationship between content of malonic aldehyde, activity of glutathione peroxidase and polymorphism of gene GPX4 (718C/T) under chronic hepatitis C].
25851338 2015 Genetic Variations in Glutathione Pathway Genes Predict Cancer Recurrence in Patients Treated with Transurethral Resection and Bacillus Calmette-Guerin Instillation for Non-muscle Invasive Bladder Cancer.
25574043 2015 Role of glutathione peroxidase 4 in conjunctival epithelial cells.
25516417 2016 Glutathione peroxidase 4 is reversibly induced by HCV to control lipid peroxidation and to increase virion infectivity.
24706940 2014 Mutations in the enzyme glutathione peroxidase 4 cause Sedaghatian-type spondylometaphyseal dysplasia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24191733 2013 Mapping of the N-linked glycoproteome of human spermatozoa.
More...