Property Summary

NCBI Gene PubMed Count 24
Grant Count 9
R01 Count 3
Funding $808,205.67
PubMed Score 14.25
PubTator Score 17.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.300 0.001
malignant mesothelioma -1.700 0.000
osteosarcoma -2.578 0.003
posterior fossa group B ependymoma 4.000 0.000
medulloblastoma, large-cell -1.600 0.000
Duchenne muscular dystrophy -1.272 0.000
lung cancer 2.600 0.000
active Crohn's disease 1.710 0.002
atypical teratoid/rhabdoid tumor -1.100 0.029
group 4 medulloblastoma -1.600 0.039
pancreatic carcinoma 1.300 0.001
Endometriosis -1.448 0.029
Pick disease 1.600 0.020
Breast cancer -1.100 0.001
acute myeloid leukemia -2.000 0.001

Gene RIF (3)

PMID Text
24139804 GMPR as a suppressor of melanoma invasion is downregulated at the early invasive stages of melanoma progression and whose activity inhibits melanoma cell invasion by depleting intracellular GTP pools.
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH      1 - 70
SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE     71 - 140
FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH    141 - 210
GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAG    211 - 280
GVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS         281 - 345
//

Text Mined References (25)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24139804 2013 A purine nucleotide biosynthesis enzyme guanosine monophosphate reductase is a suppressor of melanoma invasion.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
22331829 2012 Genetic determinants of statin-induced low-density lipoprotein cholesterol reduction: the Justification for the Use of Statins in Prevention: an Intervention Trial Evaluating Rosuvastatin (JUPITER) trial.
21269460 2011 Initial characterization of the human central proteome.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...