Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.25
PubTator Score 17.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 5.42205938771982E-14
Duchenne muscular dystrophy 602 9.15711713749745E-9
malignant mesothelioma 3163 2.33982119299641E-7
lung cancer 4473 4.7235768651216E-6
medulloblastoma, large-cell 6234 3.88455289507741E-4
Breast cancer 3099 0.00101087236500854
pancreatic cancer 2300 0.00106437429561792
pancreatic carcinoma 567 0.00106437429561794
acute myeloid leukemia 785 0.00133033587898449
active Crohn's disease 918 0.00204186209916393
osteosarcoma 7933 0.00271686122907361
Pick disease 1893 0.0197305116078658
atypical teratoid/rhabdoid tumor 1095 0.02884173492569
Endometriosis 535 0.0293991976792703
group 4 medulloblastoma 1875 0.038581854907344
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Mental depression 58 0.0 1.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 1 16 3.208 1.6

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.300 0.001
malignant mesothelioma -1.700 0.000
osteosarcoma -2.578 0.003
posterior fossa group B ependymoma 4.000 0.000
medulloblastoma, large-cell -1.600 0.000
Duchenne muscular dystrophy -1.272 0.000
lung cancer 2.600 0.000
active Crohn's disease 1.710 0.002
atypical teratoid/rhabdoid tumor -1.100 0.029
group 4 medulloblastoma -1.600 0.039
pancreatic carcinoma 1.300 0.001
Endometriosis -1.448 0.029
Pick disease 1.600 0.020
Breast cancer -1.100 0.001
acute myeloid leukemia -2.000 0.001

Synonym

Accession P36959 Q96HQ6 GMPR 1
Symbols GMPR1
GMPR 1

Gene

PANTHER Protein Class (2)

PDB

2BLE   2BWG  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
24139804 GMPR as a suppressor of melanoma invasion is downregulated at the early invasive stages of melanoma progression and whose activity inhibits melanoma cell invasion by depleting intracellular GTP pools.
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH      1 - 70
SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE     71 - 140
FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH    141 - 210
GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAG    211 - 280
GVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS         281 - 345
//

Text Mined References (25)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24139804 2013 A purine nucleotide biosynthesis enzyme guanosine monophosphate reductase is a suppressor of melanoma invasion.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
22331829 2012 Genetic determinants of statin-induced low-density lipoprotein cholesterol reduction: the Justification for the Use of Statins in Prevention: an Intervention Trial Evaluating Rosuvastatin (JUPITER) trial.
21269460 2011 Initial characterization of the human central proteome.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...