Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.43
PubTator Score 17.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.710 2.0e-03
acute myeloid leukemia -2.000 1.3e-03
atypical teratoid/rhabdoid tumor -1.100 2.9e-02
Breast cancer -1.100 1.0e-03
Duchenne muscular dystrophy -1.272 9.2e-09
Endometriosis -1.448 2.9e-02
ependymoma 2.900 2.2e-07
group 4 medulloblastoma -1.600 3.9e-02
lung cancer 2.600 4.7e-06
malignant mesothelioma -1.700 2.3e-07
medulloblastoma, large-cell -1.600 3.9e-04
osteosarcoma -2.578 2.7e-03
pancreatic cancer 1.300 1.1e-03
pancreatic carcinoma 1.300 1.1e-03
Pick disease 1.600 2.0e-02

Synonym

Accession P36959 Q96HQ6 GMPR 1
Symbols GMPR1
GMPR 1

Gene

PANTHER Protein Class (2)

PDB

2BLE   2BWG  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH      1 - 70
SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE     71 - 140
FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH    141 - 210
GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAG    211 - 280
GVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS         281 - 345
//

Text Mined References (25)

PMID Year Title