Property Summary

NCBI Gene PubMed Count 279
Grant Count 342
R01 Count 224
Funding $30,351,117.67
PubMed Score 1134.63
PubTator Score 484.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis 2.300 0.000
ependymoma 1.100 0.000
astrocytoma 1.300 0.024
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.100 0.000
acute quadriplegic myopathy 1.331 0.000
adrenocortical carcinoma -1.440 0.000
subependymal giant cell astrocytoma 1.551 0.019
Breast cancer 1.100 0.000
ovarian cancer 1.100 0.000
pituitary cancer 1.900 0.000

Synonym

Accession P36956 B0I4X3 B0I4X4 D3DXC4 Q16062 Q59F52 Q6P4R7 Q6PFW7 Q6PJ36 Q8TAK9 SREBP-1
Symbols SREBP1
bHLHd1
SREBP1a
SREBP-1c

Gene

PDB

1AM9  

 GWAS Trait (1)

Gene RIF (260)

PMID Text
26869449 hnRNP A1 is implicated in the free fatty acid-induced expression of SREBP-1a and of its target genes as well as in the lipid accumulation in hepatocytes.
26855332 Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation.
26830228 miR-33b is highly induced upon differentiation of human preadipocytes, along with SREBP-1 and miR-33b is an important regulator of adipogenesis
26771965 Report PCR techniques for genotyping SREBF1 rs8066560 variant in Iranian children/adolescents with metabolic syndrome.
26759235 PRMT5-induced methylation prevented phosphorylation of SREBP1a on S430 by GSK3beta
26698881 Data suggest that Hepacivirus (HCV) activates hepatocyte NLRP3 inflammasomes, induces lipogenic enzymes/lipid droplet formation, and up-regulates transport of SREBF1/SREBF2/SCAP from ER to Golgi where SREBPs undergo proteolytic activation by S1P/S2P.
26555173 Data indicate that glucose-mediated glycosylation promotes SREBP cleavage-activating protein (SCAP) trafficking to the Golgi Leading to sterol regulatory element binding protein 1 (SREBP-1) activation.
26512780 Data show that mutant p53 protein activates the sterol regulatory element-binding proteins SREBP-1 and SREBP-2-mediated signaling pathways in prostate cancer (PCa) cells.
26469385 HIV-1 MA increases SREBF1 mRNA expression in HepG2 cells and praimary hepatocytes
26392539 Data show that the cleavage site of the lipid-signaling protein sterol regulatory element binding transcription factor 1 (SREBP-1) intermediate bears rigid alpha-helical topology.
More...

AA Sequence

MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPG      1 - 70
SLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPL     71 - 140
PGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVP    141 - 210
QQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGP    211 - 280
LPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLV    281 - 350
VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE    351 - 420
VEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL    421 - 490
CTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVS    491 - 560
LVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWN    561 - 630
LIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSAL    631 - 700
NLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHR    701 - 770
FFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYL    771 - 840
QLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQE    841 - 910
SERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQLFLCDLLLVV    911 - 980
RTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASP    981 - 1050
TRTHQLLDRSLRRRAGPGGKGGAVAELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLE   1051 - 1120
KLGDRRLLHDCQQMLMRLGGGTTVTSS                                              1121 - 1147
//

Text Mined References (283)

PMID Year Title
26869449 2016 Lipid accumulation stimulates the cap-independent translation of SREBP-1a mRNA by promoting hnRNP A1 binding to its 5'-UTR in a cellular model of hepatic steatosis.
26855332 2016 PI3K-Akt signaling pathway upregulates hepatitis C virus RNA translation through the activation of SREBPs.
26830228 2016 SREBP-1c/MicroRNA 33b Genomic Loci Control Adipocyte Differentiation.
26771965 Comparison of TaqMan Real-Time and Tetra-Primer ARMS PCR Techniques for Genotyping of Rs 8066560 Variant in Children and Adolescents with Metabolic Syndrome.
26759235 2016 Arginine Methylation of SREBP1a via PRMT5 Promotes De Novo Lipogenesis and Tumor Growth.
26698881 2016 The Hepatitis C Virus-induced NLRP3 Inflammasome Activates the Sterol Regulatory Element-binding Protein (SREBP) and Regulates Lipid Metabolism.
26555173 2015 Glucose-Mediated N-glycosylation of SCAP Is Essential for SREBP-1 Activation and Tumor Growth.
26512780 2015 Anti-cancer efficacy of SREBP inhibitor, alone or in combination with docetaxel, in prostate cancer harboring p53 mutations.
26392539 2015 The membrane anchor of the transcriptional activator SREBP is characterized by intrinsic conformational flexibility.
26321664 2015 Identification of human ELOVL5 enhancer regions controlled by SREBP.
More...