Property Summary

NCBI Gene PubMed Count 304
PubMed Score 1267.35
PubTator Score 484.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.331 3.7e-06
adrenocortical carcinoma -1.440 5.9e-05
astrocytoma 1.300 2.4e-02
atypical teratoid / rhabdoid tumor 1.400 1.3e-05
Breast cancer 1.100 1.2e-04
ependymoma 1.100 1.7e-05
glioblastoma 1.100 2.0e-04
malignant mesothelioma 1.300 2.1e-06
ovarian cancer 1.100 3.7e-04
pituitary cancer 1.900 5.4e-05
psoriasis 2.300 5.9e-05
subependymal giant cell astrocytoma 1.551 1.9e-02

Protein-protein Interaction (2)

Gene RIF (281)

AA Sequence

MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPG      1 - 70
SLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPL     71 - 140
PGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVP    141 - 210
QQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGP    211 - 280
LPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLV    281 - 350
VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE    351 - 420
VEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL    421 - 490
CTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVS    491 - 560
LVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWN    561 - 630
LIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSAL    631 - 700
NLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHR    701 - 770
FFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYL    771 - 840
QLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQE    841 - 910
SERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQLFLCDLLLVV    911 - 980
RTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASP    981 - 1050
TRTHQLLDRSLRRRAGPGGKGGAVAELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLE   1051 - 1120
KLGDRRLLHDCQQMLMRLGGGTTVTSS                                              1121 - 1147
//

Text Mined References (308)

PMID Year Title