Property Summary

NCBI Gene PubMed Count 263
PubMed Score 137.94
PubTator Score 244.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 5.703 2.9
Disease Target Count Z-score Confidence
Eye disease 62 4.21 2.1
Bruck syndrome 10 4.011 2.0

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.886 1.2e-02
astrocytic glioma -2.000 3.0e-03
chronic lymphosyte leukemia 1.500 2.8e-05
cystic fibrosis 2.508 3.8e-07
ductal carcinoma in situ -1.200 2.2e-02
ependymoma -2.600 1.1e-03
fibroadenoma -1.800 2.6e-03
gastric carcinoma 1.700 8.1e-03
glioblastoma 1.200 3.4e-02
intraductal papillary-mucinous adenoma (... -3.800 9.2e-05
intraductal papillary-mucinous carcinoma... -4.400 9.3e-05
intraductal papillary-mucinous neoplasm ... -3.400 1.2e-02
invasive ductal carcinoma -1.600 1.9e-03
lung cancer -1.700 6.4e-05
lung carcinoma -1.700 7.2e-05
malignant mesothelioma 1.400 3.0e-05
oligodendroglioma -1.900 1.0e-02
ovarian cancer -1.500 2.1e-03
pancreatic cancer 2.400 5.1e-05
pancreatic ductal adenocarcinoma liver m... -2.555 7.1e-03
primitive neuroectodermal tumor -2.100 7.4e-04
ulcerative colitis 2.100 3.8e-04

Protein-protein Interaction (4)

Gene RIF (230)

AA Sequence

MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRS      1 - 70
STSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSAS     71 - 140
RIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGV    141 - 210
AHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPL    211 - 280
KVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKP    281 - 350
IKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP      351 - 418
//

Text Mined References (270)

PMID Year Title