Property Summary

NCBI Gene PubMed Count 246
Grant Count 102
R01 Count 19
Funding $12,449,789.69
PubMed Score 127.85
PubTator Score 244.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P36955 F1T092 Q13236 Q2TU83 Q96CT1 Q96R01 Q9BWA4 PEDF
Symbols OI6
OI12
PEDF
EPC-1
PIG35

Gene

PDB

1IMV  

Gene RIF (213)

PMID Text
26966066 We conclude that under OGD condition, PEDF and 44mer reduce H9c2 cells apoptosis and inhibit OGD-induced oxidative stress via its receptor PEDF-R and the PPARgamma signaling pathway.
26746675 Study discuss the anti-tumor activities of PEDF and focus on its dual role as an inhibitor (e.g., angiogenesis) and as an inducer of various vital biological processes that lead to the therapeutic effect via different mechanisms of action. [review]
26700654 Study demonstrated the inhibitory effect of PEDF on insulin-dependent molecular mechanisms of glucose homeostasis, and suggests that PEDF could be a specific target in the management of metabolic disorders.
26697494 We showed that transplantation of pigment epithelial cells overexpressing PEDF can restore a permissive subretinal environment for RPE and photoreceptor maintenance, while inhibiting choroidal blood vessel growth.
26612427 hCG-induced PEDF downregulation and VEGF upregulation are mediated by similar signaling cascades emphasizes the delicate regulation of ovarian angiogenesis.
26450919 We demonstrate that rPEDF may serve as a useful intervention to alleviate the risk of tamoxifen-induced endometrial pathologies
26427478 Studies indicate that pigment epithelium-derived factor (PEDF) is a natural protein of the retina .
26333415 Thus PEDF could be involved in the establishment of the avascular nature of seminiferous tubules and after puberty androgens may further reinforce this feature.
26308290 Data suggest differences in regulation of expression of PEDF (up-regulation) vs. VEGF (down-regulation) in granulosa cells explain reduced risk of ovarian hyperstimulation syndrome due to ovulation induction using GnRH/GNRHR agonists rather than hCG.
26304116 region composed of positions 98-114 of PEDF contains critical residues for PEDF-R interaction that mediates survival effects, the findings reveal distinct small PEDF fragments with neurotrophic effects on photoreceptors
More...

AA Sequence

MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRS      1 - 70
STSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSAS     71 - 140
RIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGV    141 - 210
AHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPL    211 - 280
KVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKP    281 - 350
IKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP      351 - 418
//

Text Mined References (253)

PMID Year Title
27056980 2016 Mutations and altered expression of SERPINF1 in patients with familial otosclerosis.
26966066 2016 PEDF and PEDF-derived peptide 44mer inhibit oxygen-glucose deprivation-induced oxidative stress through upregulating PPAR? via PEDF-R in H9c2 cells.
26746675 2016 Anti-tumor effects of pigment epithelium-derived factor (PEDF): implication for cancer therapy. A mini-review.
26700654 2016 PEDF attenuates insulin-dependent molecular pathways of glucose homeostasis in skeletal myocytes.
26697494 2015 Antiangiogenic and Neurogenic Activities of Sleeping Beauty-Mediated PEDF-Transfected RPE Cells In Vitro and In Vivo.
26612427 2016 Pigment epithelium-derived factor regulation by human chorionic gonadotropin in granulosa cells.
26450919 2015 Pigment Epithelium-Derived Factor Alleviates Tamoxifen-Induced Endometrial Hyperplasia.
26427478 2016 Pigment Epithelium-Derived Factor, a Protective Factor for Photoreceptors in Vivo.
26333415 2015 Human testicular peritubular cells secrete pigment epithelium-derived factor (PEDF), which may be responsible for the avascularity of the seminiferous tubules.
26308290 2015 GnRH Agonist Triggering Modulates PEDF to VEGF Ratio Inversely to hCG in Granulosa Cells.
More...