Property Summary

NCBI Gene PubMed Count 72
PubMed Score 20.75
PubTator Score 7.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.400 2.0e-03
lung cancer 1.400 5.8e-03
Multiple myeloma 1.237 1.9e-03
non primary Sjogren syndrome sicca 1.100 3.6e-02
osteosarcoma -1.168 8.7e-03
ovarian cancer 2.000 1.1e-06

Gene RIF (78)

AA Sequence

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIA      1 - 70
DVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE                    71 - 125
//

Text Mined References (75)

PMID Year Title