Property Summary

NCBI Gene PubMed Count 72
PubMed Score 20.67
PubTator Score 7.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.11208473733025E-6
lung cancer 4473 3.09897893246168E-4
Multiple myeloma 1328 0.00188900702678424
diabetes mellitus 1663 0.00201709449968299
osteosarcoma 7933 0.00865233209738592
non primary Sjogren syndrome sicca 840 0.0356802269624148
Disease Target Count Z-score Confidence
Cockayne syndrome 54 4.824 2.4
Photosensitive trichothiodystrophy 24 3.796 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.237 0.002
osteosarcoma -1.168 0.009
lung cancer 1.500 0.000
diabetes mellitus -1.400 0.002
non primary Sjogren syndrome sicca 1.100 0.036
ovarian cancer 2.000 0.000

Synonym

Accession P36954 B2R5J2 Q6NW05 RNA polymerase II subunit B9
Symbols RPB9
hRPB14.5

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (78)

PMID Text
24359561 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24330569 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23827503 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23274668 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23087374 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23028129 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22567366 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22422068 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22229121 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
More...

AA Sequence

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIA      1 - 70
DVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE                    71 - 125
//

Text Mined References (75)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12887902 2003 Acetylation of Tat defines a cyclinT1-independent step in HIV transactivation.
12676794 2003 The RNA polymerase II elongation complex.
12642036 2003 HIV-1 Vpr binding to HIV-1 LTR C/EBP cis-acting elements and adjacent regions is sequence-specific.
12634356 2003 Human immunodeficiency virus type 1 (HIV-1) Vpr enhances expression from unintegrated HIV-1 DNA.
More...