Property Summary

NCBI Gene PubMed Count 207
PubMed Score 1104.76
PubTator Score 448.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis 4.053 4.0e-02
Breast cancer -3.500 2.7e-09
breast carcinoma -1.800 2.3e-19
colon cancer 5.500 8.2e-05
interstitial cystitis -2.900 2.2e-03
intraductal papillary-mucinous adenoma (... 3.600 1.1e-03
intraductal papillary-mucinous carcinoma... 4.900 1.0e-04
intraductal papillary-mucinous neoplasm ... 4.700 9.3e-04
lung adenocarcinoma 1.200 1.0e-02
lung cancer 2.200 1.2e-04
non-small cell lung cancer 4.831 1.7e-16
ovarian cancer 1.300 2.7e-03
pancreatic cancer 3.400 8.9e-08
spina bifida -2.063 4.4e-02

Gene RIF (196)

AA Sequence

MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGF      1 - 70
QTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLT     71 - 140
DGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMNMEATFCMGNID    141 - 210
SINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEK    211 - 280
MIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNA    281 - 350
DHPFIYIIRHNKTRNIIFFGKFCSP                                                 351 - 375
//

Text Mined References (213)

PMID Year Title