Property Summary

NCBI Gene PubMed Count 189
Grant Count 160
R01 Count 101
Funding $16,840,462.87
PubMed Score 1078.80
PubTator Score 448.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P36952 B2R6Y4 Q6N0B4 Q8WW89
Symbols PI5
maspin

Gene

PDB

1WZ9   1XQG   1XQJ   1XU8  

Gene RIF (178)

PMID Text
26733306 Study shows that Maspin could enhance cisplatin chemosensitivity induced by cell apoptosis in muscle invasive bladder cancer (MIBC) cell lines. Its expression correlated with prognosis of MIBC patients who received cisplatin-based chemotherapy.
26614844 In this review, we discuss the maspin and maspin/HDAC1 interplay in tumor biology and immunology--{REVIEW}
26497917 Results suggest insight into the dynamics of maspin as a metastasis suppressor gene for further molecular research.
26456962 Suggest maspin as immunohistochemical marker anticipating survival in non-small cell lung carcinomas.
26362203 maspin is a useful addition to the diagnostic immunohistochemical panel (S100P, pVHL, and insulin-like growth factor II mRNA-binding protein 3) to help distinguish malignant from benign epithelia on challenging bile duct biopsies.
26329803 The expression of maspin in the A549 and SPCA1 cells was hardly detected.
26296971 Data suggest that hepatitis B virus X protein (HBx) induces gene expressions of microRNAs microRNA-7, -21, and -107 to target the 3' untranslational region (3' UTR) of maspin mRNA.
26263377 The methylation status of the maspin promoter is an important factor that affects the migration and invasion of EVT cells during early pregnancy.
26208903 Depending on maspin expression, tumor cells in suspension and 3D collagen I show the phenotypes of stem-like and dormant tumor cell populations, respectively. Maspin reduces prostate tumor cell plasticity and enhances tumor sensitivity to salinomycin.
26124368 Maspin was not expressed in the normal mucosa.
More...

AA Sequence

MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGF      1 - 70
QTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLT     71 - 140
DGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMNMEATFCMGNID    141 - 210
SINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEK    211 - 280
MIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNA    281 - 350
DHPFIYIIRHNKTRNIIFFGKFCSP                                                 351 - 375
//

Text Mined References (195)

PMID Year Title
26733306 2016 Maspin enhances cisplatin chemosensitivity in bladder cancer T24 and 5637 cells and correlates with prognosis of muscle-invasive bladder cancer patients receiving cisplatin based neoadjuvant chemotherapy.
26614844 2015 Tumor suppressor maspin as a modulator of host immune response to cancer.
26497917 2016 An in silico model to demonstrate the effects of Maspin on cancer cell dynamics.
26456962 2015 Expression of p63, TTF-1 and Maspin in Non-Small Cell Lung Carcinoma and Their Effect on the Prognosis and Differential Diagnosis.
26362203 2015 Diagnostic value of maspin in distinguishing adenocarcinoma from benign biliary epithelium on endoscopic bile duct biopsy.
26329803 2015 Different maspin functions in the lung adenocarcinoma A549 and SPC-A1 cell lines.
26296971 2015 miRNA-7/21/107 contribute to HBx-induced hepatocellular carcinoma progression through suppression of maspin.
26263377 2015 Promoter Hypomethylation of Maspin Inhibits Migration and Invasion of Extravillous Trophoblast Cells during Placentation.
26208903 2015 Maspin Expression in Prostate Tumor Cells Averts Stemness and Stratifies Drug Sensitivity.
26124368 2015 Maspin, a Marker of Serrated Colorectal Polyps.
More...