Property Summary

NCBI Gene PubMed Count 79
PubMed Score 249.86
PubTator Score 147.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Malaria 160 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 4.7e-07
tuberculosis 2010 3.3e-06
psoriasis 6694 8.5e-05
subependymal giant cell astrocytoma 2287 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Ankylosing spondylitis 140 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.031 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
ovarian cancer 1.300 4.7e-07
psoriasis 1.600 8.5e-05
subependymal giant cell astrocytoma 1.142 2.4e-03
tuberculosis 1.200 3.3e-06

Gene RIF (44)

AA Sequence

MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSA      1 - 70
KCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECT     71 - 140
HCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTC    141 - 210
KNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEP    211 - 280
PKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHV    281 - 350
TGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA    351 - 420
TPSNRGPRNQFITHD                                                           421 - 435
//

Text Mined References (82)

PMID Year Title