Property Summary

NCBI Gene PubMed Count 76
Grant Count 587
R01 Count 386
Funding $70,436,911.98
PubMed Score 239.37
PubTator Score 147.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.600 0.000
tuberculosis 1.200 0.000
subependymal giant cell astrocytoma 1.142 0.002
ovarian cancer 1.300 0.000

Synonym

Accession P36941 B7Z1D2 D3DUR2 F5GXE7
Symbols CD18
TNFCR
TNFR3
D12S370
TNFR-RP
TNFRSF3
TNFR2-RP
LT-BETA-R
TNF-R-III

Gene

PDB

4MXW   1RF3  

 GWAS Trait (1)

Gene RIF (41)

PMID Text
25887375 activation enhances the LPS-induced expression of IL-8 through NF-kappaB and IRF-1
25501580 LIGHT, via LTbetaR signaling, may contribute to exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells.
24980868 Relative expression of HVEM and LTbetaR modulates canonical NF-kappaB and pro-apoptotic signals stimulated by LIGHT.
24563505 lymphotoxin-B-specific receptor.
24248355 Dimerization of LTbetaR by LTalpha1beta2 is necessary and sufficient for signal transduction.
23524463 Studies indicate roles for Lymphotoxin-alpha (LTalpha) and lymphotoxin-beta receptor (LTbetaR) pathway in innate and adaptive immune responses to microorganisms.
22417320 LTBR gene polymorphisms may be associated with risk of IgA nephropathy in Korean children
22044682 Results suggest that blockade of lymphotoxin-beta receptor (LTBR) pathways may have therapeutic potential for treatment of Sjogren's syndrome.
21245292 show that a cognate interaction between LTalphabeta on CD4(+) helper T cells and LTbeta receptor on DCs results in unique signals that are necessary for optimal CD8(+) T-cell expansion via a type I IFN-dependent mechanism
21195057 These results indicated that AdipoR1 interacted with LTBR and mediated the inhibition of LTBR-activated NF-kappaB pathway.
More...

AA Sequence

MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSA      1 - 70
KCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECT     71 - 140
HCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTC    141 - 210
KNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEP    211 - 280
PKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHV    281 - 350
TGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA    351 - 420
TPSNRGPRNQFITHD                                                           421 - 435
//

Text Mined References (79)

PMID Year Title
26977880 2016 Facilitating T Cell Infiltration in Tumor Microenvironment Overcomes Resistance to PD-L1 Blockade.
25887375 2015 Activation of lymphotoxin-beta receptor enhances the LPS-induced expression of IL-8 through NF-?B and IRF-1.
25501580 2014 Lymphotoxin ? receptor signaling induces IL-8 production in human bronchial epithelial cells.
24980868 2014 Herpesvirus entry mediator (HVEM) attenuates signals mediated by the lymphotoxin ? receptor (LT?R) in human cells stimulated by the shared ligand LIGHT.
24563505 2014 Pillars article: A lymphotoxin-B-specific receptor. Science. 1994. 264: 707-710.
24248355 2013 Dimerization of LT?R by LT?1?2 is necessary and sufficient for signal transduction.
23524463 2013 Lymphotoxin signalling in immune homeostasis and the control of microorganisms.
22417320 2012 Association between lymphotoxin beta receptor gene polymorphisms and IgA nephropathy in Korean children.
22152226 Biology and signal transduction pathways of the Lymphotoxin-??/LT?R system.
22044682 2011 Lymphotoxin-beta receptor blockade reduces CXCL13 in lacrimal glands and improves corneal integrity in the NOD model of Sjögren's syndrome.
More...