Property Summary

NCBI Gene PubMed Count 373
Grant Count 257
R01 Count 197
Funding $17,427,556.08
PubMed Score 654.47
PubTator Score 479.94

Knowledge Summary

Patent (30,289)

Expression

Synonym

Accession P36897 Q6IR47 Q706C0 Q706C1 TGFR-1
Symbols AAT5
ALK5
ESS1
LDS1
MSSE
SKR4
ALK-5
LDS1A
LDS2A
TGFR-1
ACVRLK4
tbetaR-I

Gene

PDB

2PJY   3KFD   1B6C   1IAS   1PY5   1RW8   1TBI   1VJY   2L5S   2WOT   2WOU   2X7O   3FAA   3GXL   3HMM   3KCF   3TZM   4X0M   4X2F   4X2G   4X2J   4X2K   4X2N   5E8S   5E8T   5E8U   5E8W   5E8X   5E8Z   5E90   5FRI  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
686923 other 8 / 0 / 2 In vitrocounter assay of key BMP4 Inhibitors

Gene RIF (304)

PMID Text
27048361 This paper highlights that targeting the BMP and TGFbeta type I and type II receptors causes a downregulation of XIAP, TAK1, and Id1 leading to cell death of lung cancer cells.
26872091 Data suggest that transient suppression of TGFbeta receptor I (TGFbeta receptor) signaling may improve the outcome of islet transplantation.
26766164 Evidence supporting a genetic basis includes the autosomal dominance of Bicuspid aortic valve inheritance patterns, and the identification of mutations in transforming growth factor beta receptor 1.
26720610 Short hairpin-mediated downregulation of either ALK5 or ALK1 resulted in a strong inhibition of TGFbeta-induced chondrogenesis.
26652004 This work details a novel mechanism by which cellular tension regulates TGFbeta receptor organization, multimerization, and function.
26620926 miR-181b functions as a tumor suppressor and has an important role in proliferation, chemosensitivity to DDP and metastasis of NSCLC by targeting TGFbetaR1/Smad signaling pathway.
26616150 Studies indicate that the transforming growth factor beta receptor I 6A (TbetaR-I 6A) allele was associated with breast cancer risk.
26583432 Data show that signal transducing adaptor proteins APPL1 and APPL2 are required for TGFbeta-induced nuclear translocation of TGFbeta type I receptor (TbetaRI)-ICD and for cancer cell invasiveness of prostate and breast cancer cell lines.
26583147 the level of TGFBR1 and early osteogenic differentiation were abolished in the DPSCs transfected with siRNA for GnT-V knockdown...GnT-V plays a critical role in the hexosamine-induced activation of TGF-b signaling and osteogenic differentiation
26548632 Protease activated receptor-1 mediated dual kinase receptor transactivation stimulates the expression of glycosaminoglycan synthesizing genes and transforming growth factor beta receptor 1
More...

AA Sequence

MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSM      1 - 70
CIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCIS     71 - 140
LMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQES    141 - 210
IGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVS    211 - 280
DYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIA    281 - 350
DLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI    351 - 420
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKK    421 - 490
TLSQLSQQEGIKM                                                             491 - 503
//

Text Mined References (380)

PMID Year Title
27048361 2016 Inhibition of BMP and of TGF? receptors downregulates expression of XIAP and TAK1 leading to lung cancer cell death.
26872091 2016 Transient Suppression of TGF? Receptor Signaling Facilitates Human Islet Transplantation.
26766164 2016 Advances in aortic disease management: a year in review.
26720610 2015 Activin Receptor-Like Kinase Receptors ALK5 and ALK1 Are Both Required for TGF?-Induced Chondrogenic Differentiation of Human Bone Marrow-Derived Mesenchymal Stem Cells.
26652004 2015 Discrete spatial organization of TGF? receptors couples receptor multimerization and signaling to cellular tension.
26620926 2015 MiR-181b regulates cisplatin chemosensitivity and metastasis by targeting TGF?R1/Smad signaling pathway in NSCLC.
26616150 2015 Meta-analysis of transforming growth factor ? receptor I 6A/9A gene polymorphism and breast cancer risk: the picture remains murky.
26583432 2016 APPL proteins promote TGF?-induced nuclear transport of the TGF? type I receptor intracellular domain.
26583147 2015 Hexosamine-Induced TGF-? Signaling and Osteogenic Differentiation of Dental Pulp Stem Cells Are Dependent on N-Acetylglucosaminyltransferase V.
26548632 2016 Protease activated receptor-1 mediated dual kinase receptor transactivation stimulates the expression of glycosaminoglycan synthesizing genes.
More...