Property Summary

Ligand Count 279
NCBI Gene PubMed Count 392
PubMed Score 847.94
PubTator Score 479.94

Knowledge Summary

Patent (30,289)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 3.0
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 5.0
Thoracic aortic aneurysm 15 0.0 5.0

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.546 1.2e-02
active ulcerative colitis 1.008 1.0e-02
acute quadriplegic myopathy 1.235 2.7e-05
adult high grade glioma 1.800 1.3e-03
astrocytoma 1.300 8.0e-14
Astrocytoma, Pilocytic 2.000 5.8e-07
Breast cancer 2.100 4.5e-02
ependymoma 1.200 1.7e-02
Gaucher disease type 1 -1.600 1.9e-02
glioblastoma 1.900 2.8e-10
group 3 medulloblastoma 2.700 5.2e-04
intraductal papillary-mucinous adenoma (... 1.600 3.0e-02
juvenile dermatomyositis 1.132 1.6e-10
medulloblastoma, large-cell 2.200 5.7e-04
oligodendroglioma 1.100 4.1e-08
osteosarcoma 2.403 9.5e-04
ovarian cancer 1.400 2.2e-02
pancreatic cancer 1.600 2.6e-02
primitive neuroectodermal tumor 2.000 4.6e-05

Synonym

Accession P36897 Q6IR47 Q706C0 Q706C1 TGFR-1
Symbols AAT5
ALK5
ESS1
LDS1
MSSE
SKR4
TBRI
ALK-5
LDS1A
LDS2A
TBR-i
TGFR-1
ACVRLK4
tbetaR-I

Gene

PDB

2PJY   3KFD   1B6C   1IAS   1PY5   1RW8   1TBI   1VJY   2L5S   2WOT   2WOU   2X7O   3FAA   3GXL   3HMM   3KCF   3TZM   4X0M   4X2F   4X2G   4X2J   4X2K   4X2N   5E8S   5E8T   5E8U   5E8W   5E8X   5E8Z   5E90   5FRI   5USQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (322)

AA Sequence

MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSM      1 - 70
CIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCIS     71 - 140
LMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQES    141 - 210
IGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVS    211 - 280
DYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIA    281 - 350
DLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI    351 - 420
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKK    421 - 490
TLSQLSQQEGIKM                                                             491 - 503
//

Text Mined References (399)

PMID Year Title