Property Summary

NCBI Gene PubMed Count 60
Grant Count 47
R01 Count 27
Funding $4,721,057.14
PubMed Score 76.38
PubTator Score 61.62

Knowledge Summary

Patent (13,317)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytic glioma -1.100 0.003
psoriasis -1.200 0.024
osteosarcoma 1.382 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.100 0.001
interstitial cystitis -1.200 0.000
adult high grade glioma -1.200 0.000
ulcerative colitis -1.300 0.000
ovarian cancer 1.300 0.001

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
686923 other 8 / 0 / 2 In vitrocounter assay of key BMP4 Inhibitors

Gene RIF (26)

PMID Text
26305619 Data suggest that activin A up-regulates SNAIL expression via ALK4/ACVR1B-induced SMAD signaling in trophoblast cells; elevated SNAIL contributes to up-regulation of MMP2 expression which plays key role in promoting trophoblast cell invasion.
26289399 ALK4 is expressed in male germ cells and Sertoli cells.
26149389 This study demonstrated positive regulation of monocyte/macrophage differentiation by lnc-MC and uncovered an elaborate regulation mechanism composed of PU.1, lnc-MC, miR-199a-5p, and ACVR1B.
25258381 ACVR1B functions as a positive regulator of monocyte/macrophage differentiation. ACVR1B knockdown promoted THP-1 proliferation by increasing Rb phosphorylation. Down-regulation reduced p-Smad2/3 and C/EBPalpha, inhibiting monocyte/macrophage differentiation.
24886203 The deletion of the ACVR1B gene may mediate an aggressive cancer phenotype in pancreatic cancer.
23211491 Findings define a regulatory role of miR-98 in tumor angiogenesis and invasion through repressed ALK4 and MMP11 expression.
23159635 ActRIBCA signaling can promote cell migration in prostate cancer cells via a network of signaling molecules that work together to trigger the process of EMT, and thereby aid in the aggressiveness and progression of prostate cancers.
23010638 Act A protein levels were significantly higher in NTM tissues compared to GTM tissues.
22267736 Inhibin alpha-subunit N terminus interacts with activin type IB receptor to disrupt activin signaling.
21377836 Activin A-ACVRIB/ALK4-Smad-dependent collagen production was augmented in SSc fibroblasts, suggesting the involvement of this signaling mechanism in systemic sclerosis.
More...

AA Sequence

MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCI      1 - 70
PKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVELVGIIAGPVFLLFL     71 - 140
IIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQ    141 - 210
EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWL    211 - 280
VSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCA    281 - 350
IADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG    351 - 420
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYANGAARLTALRI    421 - 490
KKTLSQLSVQEDVKI                                                           491 - 505
//

Text Mined References (64)

PMID Year Title
26305619 2015 Activin A Increases Human Trophoblast Invasion by Inducing SNAIL-Mediated MMP2 Up-Regulation Through ALK4.
26289399 NODAL secreted by male germ cells regulates the proliferation and function of human Sertoli cells from obstructive azoospermia and nonobstructive azoospermia patients.
26149389 2015 PU.1-Regulated Long Noncoding RNA lnc-MC Controls Human Monocyte/Macrophage Differentiation through Interaction with MicroRNA 199a-5p.
25258381 2014 miR-199a-5p inhibits monocyte/macrophage differentiation by targeting the activin A type 1B receptor gene and finally reducing C/EBP? expression.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
24886203 2014 Homozygous deletion of the activin A receptor, type IB gene is associated with an aggressive cancer phenotype in pancreatic cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23211491 2012 MicroRNA miR-98 inhibits tumor angiogenesis and invasion by targeting activin receptor-like kinase-4 and matrix metalloproteinase-11.
23159635 2013 Activin type IB receptor signaling in prostate cancer cells promotes lymph node metastasis in a xenograft model.
More...