Property Summary

Ligand Count 3
NCBI Gene PubMed Count 64
PubMed Score 91.16
PubTator Score 61.62

Knowledge Summary

Patent (13,317)

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 2.6e-03
astrocytic glioma -1.100 3.5e-03
atypical teratoid / rhabdoid tumor -1.200 2.6e-05
glioblastoma -1.100 6.8e-04
interstitial cystitis -1.200 3.9e-04
malignant mesothelioma -1.200 1.1e-05
osteosarcoma 1.382 1.7e-06
ovarian cancer 1.300 5.9e-04
psoriasis -1.200 2.4e-02
ulcerative colitis -1.300 1.6e-05

 OMIM Phenotype (1)

Gene RIF (29)

AA Sequence

MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCI      1 - 70
PKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVELVGIIAGPVFLLFL     71 - 140
IIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQ    141 - 210
EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWL    211 - 280
VSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCA    281 - 350
IADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG    351 - 420
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYANGAARLTALRI    421 - 490
KKTLSQLSVQEDVKI                                                           491 - 505
//

Text Mined References (68)

PMID Year Title