Property Summary

Ligand Count 8
NCBI Gene PubMed Count 124
PubMed Score 211.01
PubTator Score 133.33

Knowledge Summary

Patent (20,298)

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.100 2.6e-15
Astrocytoma, Pilocytic 1.200 2.1e-04
atypical teratoid / rhabdoid tumor 1.200 1.3e-04
osteosarcoma 1.441 9.5e-04
ovarian cancer -1.400 1.2e-07
posterior fossa group A ependymoma 1.100 8.9e-05
psoriasis -1.100 5.2e-07

PDB (11)

Gene RIF (79)

AA Sequence

MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDD      1 - 70
AINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP     71 - 140
VVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLI    141 - 210
DQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQT    211 - 280
VLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIY    281 - 350
GTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN    351 - 420
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSD    421 - 490
ECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI                                491 - 532
//

Text Mined References (128)

PMID Year Title