Property Summary

NCBI Gene PubMed Count 117
Grant Count 162
R01 Count 112
Funding $12,772,930.25
PubMed Score 194.12
PubTator Score 133.33

Knowledge Summary

Patent (20,298)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.100 0.000
astrocytoma 1.100 0.000
osteosarcoma -1.504 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
pilocytic astrocytoma 1.200 0.000
posterior fossa group A ependymoma 1.100 0.000
ovarian cancer -1.400 0.000

Synonym

Accession P36894 A8K6U9 Q8NEN8 BMP type-1A receptor
Symbols ALK3
SKR5
CD292
ACVRLK3
10q23del

Gene

PDB

2H62   1ES7   1REW   2GOO   2H64   2QJ9   2QJA   2QJB   2K3G   3NH7   3QB4  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
686923 other 8 / 0 / 2 In vitrocounter assay of key BMP4 Inhibitors

Gene RIF (75)

PMID Text
26585335 BMPR1A(+) ASCs show an enhanced ability for adipogenesis in vitro, as shown by gene expression and histological staining.
26383923 Duplication of 10q22.3-q23.3 encompassing BMPR1A gene is associated with congenital heart disease, microcephaly, and mild intellectual disability
26274893 Authors analyzed human databases from TCGA and survival data from microarrays to confirm BMPR1a tumor promoting functions, and found that high BMPR1a gene expression correlates with decreased survival regardless of molecular breast cancer subtype.
26171675 About half of BMPR1A-related polyps displayed loss of heterozygosity, predominantly in the epithelial compartment, compatible with BMPR1A acting as a tumour suppressor gene.
25129392 This is the first case report to document coding exon 3 duplication in the BMPR1A gene in a patient with juvenile polyposis syndrome.
24966941 The mRNA/protein expressions of BMPR1alpha was higher in the stenotic colon segment tissue than in the normal colon segment tissue of Hirschsrung disease patients.
24904118 results provide evidence that HFE induces hepcidin expression via the BMP pathway: HFE interacts with ALK3 to stabilize ALK3 protein and increase ALK3 expression at the cell surface.
24882581 Results support a novel role for miR-885-3p in tumor angiogenesis by targeting BMPR1A, which regulates a proangiogenic factor.
24850914 Data show that USP15 enhances BMP-induced phosphorylation of SMAD1 by interacting with and deubiquitylating ALK3.
24480809 High BMPR1A expression is associated with glioma tumorigenesis.
More...

AA Sequence

MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDD      1 - 70
AINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP     71 - 140
VVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLI    141 - 210
DQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQT    211 - 280
VLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIY    281 - 350
GTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN    351 - 420
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSD    421 - 490
ECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI                                491 - 532
//

Text Mined References (120)

PMID Year Title
26585335 2016 Enrichment of Adipose-Derived Stromal Cells for BMPR1A Facilitates Enhanced Adipogenesis.
26383923 2015 Duplication of 10q22.3-q23.3 encompassing BMPR1A and NGR3 associated with congenital heart disease, microcephaly, and mild intellectual disability.
26274893 2015 Deletion of the BMP receptor BMPR1a impairs mammary tumor formation and metastasis.
26171675 2015 Somatic alterations in juvenile polyps from BMPR1A and SMAD4 mutation carriers.
25129392 2014 Identification of coding exon 3 duplication in the BMPR1A gene in a patient with juvenile polyposis syndrome.
24966941 2014 Differential expressions of BMPR1?, ACTN4? and FABP7 in Hirschsprung disease.
24904118 2014 HFE interacts with the BMP type I receptor ALK3 to regulate hepcidin expression.
24882581 2015 MicroRNA-885-3p inhibits the growth of HT-29 colon cancer cell xenografts by disrupting angiogenesis via targeting BMPR1A and blocking BMP/Smad/Id1 signaling.
24850914 2014 USP15 targets ALK3/BMPR1A for deubiquitylation to enhance bone morphogenetic protein signalling.
24480809 2014 miR-656 inhibits glioma tumorigenesis through repression of BMPR1A.
More...