Property Summary

Ligand Count 15
NCBI Gene PubMed Count 83
PubMed Score 177.56
PubTator Score 65.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Ovarian Neoplasms 102 0.0 0.0
Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
Multiple myeloma 1332 1.1e-05
ovarian cancer 8520 4.0e-04
lung cancer 4740 8.1e-04
Waldenstrons macroglobulinemia 765 5.5e-03
Disease Target Count Z-score Confidence
Male infertility 206 3.139 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.200 8.1e-04
Multiple myeloma 2.130 1.1e-05
ovarian cancer -1.700 4.0e-04
Waldenstrons macroglobulinemia 1.707 5.5e-03

Gene RIF (38)

AA Sequence

MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYY      1 - 70
DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC     71 - 140
KRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPD    141 - 210
KDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG    211 - 280
AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK                               281 - 323
//

Text Mined References (100)

PMID Year Title