Property Summary

NCBI Gene PubMed Count 76
Grant Count 53
R01 Count 41
Funding $2,992,096.62
PubMed Score 172.98
PubTator Score 65.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.707 0.006
Multiple myeloma 2.130 0.000
lung cancer 1.200 0.001
ovarian cancer -1.700 0.000

Synonym

Accession P36873 PP-1G
Symbols PP1C
PP-1G
PPP1G

Gene

PDB

1IT6   1JK7   1U32   2BCD   2BDX   4UT2   4UT3  

 IMPC Term (1)

 GWAS Trait (1)

Gene RIF (41)

PMID Text
25886518 PP1gamma may be a novel target of the HPV-16 oncoproteins and indicate that it might be a potential novel biomarker for HPV-16 induced malignancy.
25073485 Small molecular compounds prevent the interaction of HIV-1 Tat with protein phosphatase-1 (PP1) and the shuttling of PP1 to the nucleus
25073485 Small molecular compounds prevent the interaction of HIV-1 Tat with protein phosphatase-1 (PP1) and the shuttling of PP1 to the nucleus
25012651 Although no obvious defects in the progression of mitosis were observed, the timing of dephosphorylation of the mutant Ki67 in anaphase was delayed, indicating that Ki67 itself is one of the substrates of PP1gamma-Ki67.
24558042 the lipin-1 N-terminal domain is important for its catalytic activity, nuclear localization, and binding to PP-1cgamma
24196533 Protein phosphatase 1gamma promotes the alternative splicing of CaMKIIdelta through its interaction with alternative splice factor.
23499489 Findings indicate that phosphatases PP1alpha and PP1gamma are key regulators of RIG-I and MDA5 antiviral signaling.
23197154 PPP1C isoforms have distinct contribution to the outside-in alphaIIbbeta3 signalling-dependent functions in HEK293 alphaIIbbeta3 cells.
23176181 PP-1alpha and PP-1gamma not only antagonize each other in lung cancer cells, but also display differential functions in tumorigenicity.
23088536 When the Px(T)PxR motif is deleted or mutated via insertion of a phosphorylation site mimic (T311D), PP-1c fails to bind to all three ASPP proteins, ASPP1, ASPP2 and iASPP.
More...

AA Sequence

MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYY      1 - 70
DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC     71 - 140
KRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPD    141 - 210
KDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG    211 - 280
AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK                               281 - 323
//

Text Mined References (93)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25886518 2015 HPV-16 impairs the subcellular distribution and levels of expression of protein phosphatase 1? in cervical malignancy.
25416956 2014 A proteome-scale map of the human interactome network.
25012651 2014 Ki67 antigen contributes to the timely accumulation of protein phosphatase 1? on anaphase chromosomes.
24867636 2014 Ki-67 is a PP1-interacting protein that organises the mitotic chromosome periphery.
24558042 2014 Conserved residues in the N terminus of lipin-1 are required for binding to protein phosphatase-1c, nuclear translocation, and phosphatidate phosphatase activity.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...