Property Summary

NCBI Gene PubMed Count 40
PubMed Score 491.49
PubTator Score 415.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 2.600 2.7e-02
breast carcinoma -1.400 8.3e-04
cystic fibrosis 1.102 2.1e-05
ductal carcinoma in situ -1.200 6.1e-03
group 4 medulloblastoma -1.500 2.7e-05
invasive ductal carcinoma -1.400 3.1e-02
malignant mesothelioma -2.400 3.6e-08
medulloblastoma, large-cell -1.200 5.3e-03
Multiple myeloma 1.161 4.5e-03
ovarian cancer -1.700 1.6e-03
pancreatic ductal adenocarcinoma liver m... -2.871 1.2e-03
Waldenstrons macroglobulinemia 1.254 8.6e-04

Gene RIF (20)

AA Sequence

MVKIVTVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEA      1 - 70
IQLIARIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAP     71 - 140
EAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRSIFDFSALKE    141 - 210
LLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGE    211 - 280
HDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKI    281 - 350
ALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILATRKQSVEDILKDHWQKY    351 - 420
GRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGL    421 - 490
RLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTV    491 - 560
IT                                                                        561 - 562
//

Text Mined References (54)

PMID Year Title