Property Summary

NCBI Gene PubMed Count 77
Grant Count 25
R01 Count 19
Funding $3,518,816
PubMed Score 223.56
PubTator Score 164.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.600 0.000
glioblastoma 1.400 0.000
group 3 medulloblastoma 2.300 0.000
medulloblastoma, large-cell 1.500 0.000
adrenocortical carcinoma 1.010 0.005
non-small cell lung cancer 1.522 0.000
lung cancer 1.500 0.001
pediatric high grade glioma 1.300 0.000
non primary Sjogren syndrome sicca 1.100 0.020
gastric carcinoma 1.500 0.035
ovarian cancer 1.400 0.000

Gene RIF (59)

PMID Text
26755138 activity of MTH1 in different breast cancer cell lines has been detected, implying the potential application of this assay method for biomedical research and clinical diagnose in the future
26520386 Results show that MTH1 plays no role in protecting the cells against ultraviolet radiation-induced cytogenetic damage.
26238318 MTH1 is the most prominent sanitizer of the cellular dNTP pool known to date.
26202347 a novel approach involving liquid chromatography-isotope-dilution tandem mass spectrometry to positively identify and accurately quantify MTH1 in human tissues, is reported.
25893378 MTH1 expression is required for effective transformation of epithelial cells by oncogenic HRAS.
25127756 Data suggest that hOGG1 could compensate for hMTH1 during oxidative DNA damage caused by H2O2, whereas hMTH1 could not compensate sufficiently for hOGG1 during the process.
25023700 results indicate MTH1 is a novel and critical component of oncogenic KRAS-associated malignancy and its inhibition is likely to yield significant tumor-suppressive outcomes in KRAS-driven tumors.
24928220 The ectopic expression of hMTH1 in the chloroplasts and mitochondria of Arabidopsis enhanced oxidative stress tolerance by activating the poly(ADP-ribosyl)ation (PAR)reaction and suppressing programmed cell death.
24695224 cancer cells require MTH1 activity to avoid incorporation of oxidized dNTPs, resulting in DNA damage and cell death; validation of MTH1 as an anticancer target in vivo
24144844 MTH1 protects cells from mutagenesis induced by ultraviolet ray A and B, but not ultraviolet ray C.hMTH1 prevents induction of transition-type mutations at AT and GC post ultraviolet ray A irradiation.
More...

AA Sequence

MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGA      1 - 70
GRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESD     71 - 140
EMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV                 141 - 197
//

Text Mined References (79)

PMID Year Title
26755138 2016 Investigation of MTH1 activity via mismatch-based DNA chain elongation.
26520386 2015 Investigation of micronucleus induction in MTH1 knockdown cells exposed to UVA, UVB or UVC.
26238318 2015 Crystal structure, biochemical and cellular activities demonstrate separate functions of MTH1 and MTH2.
26202347 2015 Addiction to MTH1 protein results in intense expression in human breast cancer tissue as measured by liquid chromatography-isotope-dilution tandem mass spectrometry.
25893378 2015 MTH1 expression is required for effective transformation by oncogenic HRAS.
25416956 2014 A proteome-scale map of the human interactome network.
25127756 2014 Compensatory effects of hOGG1 for hMTH1 in oxidative DNA damage caused by hydrogen peroxide.
25023700 2015 MutT Homolog 1 (MTH1) maintains multiple KRAS-driven pro-malignant pathways.
24928220 2014 Ectopic expression of the human MutT-type Nudix hydrolase, hMTH1, confers enhanced tolerance to oxidative stress in arabidopsis.
24695225 2014 Stereospecific targeting of MTH1 by (S)-crizotinib as an anticancer strategy.
More...