Property Summary

Ligand Count 24
NCBI Gene PubMed Count 85
PubMed Score 259.69
PubTator Score 164.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.010 4.9e-03
gastric carcinoma 1.500 3.5e-02
glioblastoma 1.400 7.3e-07
group 3 medulloblastoma 2.300 4.0e-05
lung cancer 1.500 6.2e-04
medulloblastoma, large-cell 1.500 1.9e-04
non primary Sjogren syndrome sicca 1.100 2.0e-02
non-small cell lung cancer 1.522 2.8e-16
ovarian cancer 1.400 2.0e-04
pediatric high grade glioma 1.300 3.3e-05
psoriasis 1.600 5.3e-05

Protein-protein Interaction (4)

Gene RIF (67)

AA Sequence

MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGA      1 - 70
GRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESD     71 - 140
EMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV                 141 - 197
//

Text Mined References (87)

PMID Year Title