Property Summary

NCBI Gene PubMed Count 35
PubMed Score 118.81
PubTator Score 274.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P36578 A8K502 P39029 Q4VBR0 Q969Z9
Symbols L4

Gene

PDB

4UG0   4V6X   5AJ0   5A8L  

  Ortholog (14)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
26858444 insights into the mechanisms by which EBV uses nucleolin and RPL4 to establish persistent B-lymphoblastoid cell infection
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L4 (RPL4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22718819 Mouse and human RPL4 enhance MoMLV gag-pol readthrough.
20705598 Results show that RPL4, RPLP0, and HSPCB were the most stable reference genes in ovarian tissues.

AA Sequence

MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTG      1 - 70
RAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSK     71 - 140
GHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCII    141 - 210
YNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRKAASLKSNYNLP    211 - 280
MHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR    281 - 350
VDKAAAAAAALQAKSDEKAAVAGKKPVVGKKGKKAAVGVKKQKKPLVGKKAAATKKPAPEKKPAEKKPTT    351 - 420
EEKKPAA                                                                   421 - 427
//

Text Mined References (47)

PMID Year Title
26858444 2016 Ribosome Protein L4 is essential for Epstein-Barr Virus Nuclear Antigen 1 function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22718819 2012 Large ribosomal protein 4 increases efficiency of viral recoding sequences.
More...