Property Summary

NCBI Gene PubMed Count 42
PubMed Score 112.45
PubTator Score 118.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma -1.100 2.5e-02
hepatocellular carcinoma 1.100 2.1e-05
intraductal papillary-mucinous neoplasm ... 1.400 1.3e-02
lung cancer 1.100 1.5e-03
non-small cell lung cancer 1.209 3.7e-23
osteosarcoma -2.707 3.2e-07
subependymal giant cell astrocytoma -1.868 9.0e-03

 MGI Phenotype (1)

Gene RIF (17)

AA Sequence

MALQLGRLSSGPCWLVARGGCGGPRAWSQCGGGGLRAWSQRSAAGRVCRPPGPAGTEQSRGLGHGSTSRG      1 - 70
GPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEEEDELAHRCSSFMAPPVTDLGE     71 - 140
LRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVV    141 - 210
HGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGG    211 - 280
CDLTPTYLNQEDAVHFHRTLKEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEV    281 - 350
FRFVQSCARAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMS    351 - 420
LPLTARWEYMHSPSENSKEAEILEVLRHPRDWVR                                        421 - 454
//

Text Mined References (47)

PMID Year Title