Property Summary

NCBI Gene PubMed Count 42
PubMed Score 108.09
PubTator Score 118.83

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Coproporphyria 1
Harderoporphyria 1
Disease Target Count P-value
non-small cell lung cancer 2798 3.71058604587781E-23
osteosarcoma 7933 3.19090131351376E-7
hepatocellular carcinoma 550 2.14673680191756E-5
lung cancer 4473 0.00146956629581623
subependymal giant cell astrocytoma 2287 0.00896037388772171
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0134265425282262
group 4 medulloblastoma 1875 0.0252366313548206
Disease Target Count Z-score Confidence
Porphyria 9 6.861 3.4


  Differential Expression (7)


Accession P36551 A8K275 B4DSD5 Q14060 Q53F08 Q8IZ45 Q96AF3 COX
Symbols CPO


PANTHER Protein Class (2)



  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (17)

24078084 The monomer form of mutated CPOX did not show any activity and homodimeric enzymes derived from Hereditary coproporphyria (HCP) mutant showed low activity (<20% of the control).
22765978 Polymorphism of coproporphyrinogen oxidase is associated with genetic susceptibility to the adverse neurobehavioral effects of Hg exposure in children.
22288185 CPOX polymorphisms are associated with biological media contamination and apoptosis disorders.
21277781 competitive action of both uroporphyrinogen decarboxylase and CPO on the same diacetate porphyrinogen substrate provides additional perspectives on the potential existence of abnormal pathways for heme biosynthesis
21231929 Deletion of the fifth exon in the CPOX gene is associated with hereditary coproporphyria.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19339664 biochemical & kinetic properties of CPOX4, the product of a polymorphism of the CPOX gene that modifies effects of mercury on neurobehavioral function; suggests CPOX4 may predispose to impaired heme biosynthesis which is limited further by Hg exposure
19267996 Three of the novel missense mutations and one frameshift mutation was detected in coproporphyrinogen III oxidase (CPO) gene in five Italian patients affected by Hereditary Coproporphyria (HCP).
18557518 The authors report the association of a novel mutation in the coproporphyrinogen oxidase gene in an Irish pedigree with the devlopment of hereditary coproporphyria
17179900 His158 of human CPO may have a role in the active site, but none of the conserved histidine residues of human coproporphyrinogen oxidase is essential for catalytic activity.

AA Sequence

LPLTARWEYMHSPSENSKEAEILEVLRHPRDWVR                                        421 - 454

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24078084 2013 The enzyme engineering of mutant homodimer and heterodimer of coproporphyinogen oxidase contributes to new insight into hereditary coproporphyria and harderoporphyria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22765978 Modification of neurobehavioral effects of mercury by a genetic polymorphism of coproporphyrinogen oxidase in children.
22288185 2011 [Polymorphism of TNF gene and CPOX gene in chemical industry workers].
21277781 2011 Normal and abnormal heme biosynthesis. Part 7. Synthesis and metabolism of coproporphyrinogen-III analogues with acetate or butyrate side chains on rings C and D. Development of a modified model for the active site of coproporphyrinogen oxidase.
21269460 2011 Initial characterization of the human central proteome.
21231929 2012 Identification of an AluY-mediated deletion of exon 5 in the CPOX gene by MLPA analysis in patients with hereditary coproporphyria.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.