Property Summary

NCBI Gene PubMed Count 38
Grant Count 23
R01 Count 7
Funding $1,637,114.32
PubMed Score 10.32
PubTator Score 173.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.800 0.006
ependymoma -1.900 0.009
oligodendroglioma -1.100 0.039
medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.500 0.000
adult high grade glioma -1.200 0.000
Pick disease -1.400 0.000
ovarian cancer 1.300 0.000

Gene RIF (6)

PMID Text
25072283 Low-grade PanIN lesions with typical columnar morphology displayed diffuse labeling of the V1E subunit. In advanced lesions it was found along the basolateral membranes.
22395867 The genes CECR2, SLC25A18 and ATP6V1E1, mapping within the critical region for cat eye syndrome (CES), may be responsible for anorectal, renal and preauricular anomalies in patients with CES.
16155006 HuR shows increased binding to some V-ATPase mRNAs during ATP depletion; siRNA-mediated knockdown of HuR results in diminished V-ATPase expression
12163484 Data demonstrate the physiological significance of the interaction between the E and H subunits of V-ATPase and extend previous studies on the arrangement of subunits on the peripheral stalk of V-ATPase.
11560919 The mouse V-ATPase E may participate in the regulation of the mSos1-dependent Rac1 signaling pathway involved in growth factor receptor-mediated cell growth control.
10748165 Rat vacuolar H(+)ATPase associates with NHE-RF (Na(+)/H(+) exchanger regulatory factor); the E subunit was co-immunoprecipitated from rat kidney cytosol with NHE-RF antibodies.

AA Sequence

MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKI      1 - 70
QMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQD     71 - 140
FPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPE    141 - 210
VRGALFGANANRKFLD                                                          211 - 226
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25072283 2014 Polarization of the vacuolar adenosine triphosphatase delineates a transition to high-grade pancreatic intraepithelial neoplasm lesions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
22395867 2012 A 600?kb triplication in the cat eye syndrome critical region causes anorectal, renal and preauricular anomalies in a three-generation family.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21269460 2011 Initial characterization of the human central proteome.
20717956 2011 Rab11b and its effector Rip11 regulate the acidosis-induced traffic of V-ATPase in salivary ducts.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...