Property Summary

NCBI Gene PubMed Count 39
PubMed Score 10.70
PubTator Score 173.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 2.4e-06
astrocytic glioma -1.800 6.5e-03
atypical teratoid / rhabdoid tumor -1.900 1.3e-08
ependymoma -1.900 9.4e-03
glioblastoma -1.400 2.9e-05
group 4 medulloblastoma -1.100 1.2e-06
medulloblastoma, large-cell -1.900 1.2e-06
oligodendroglioma -1.100 3.9e-02
ovarian cancer 1.300 3.2e-04
Pick disease -1.400 3.9e-04
primitive neuroectodermal tumor -1.500 2.6e-05

Gene RIF (7)

AA Sequence

MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKI      1 - 70
QMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQD     71 - 140
FPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPE    141 - 210
VRGALFGANANRKFLD                                                          211 - 226
//

Text Mined References (47)

PMID Year Title