Property Summary

NCBI Gene PubMed Count 28
PubMed Score 3.75
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.402 0.005
Multiple myeloma 1.745 0.000
lung cancer 1.100 0.006
Breast cancer 2.700 0.025
ovarian cancer 3.000 0.000

Synonym

Accession P36542 A8KA31 Q5VYP3 Q6I9V2 Q96AS8
Symbols ATP5C
ATP5CL1

Gene

Gene RIF (12)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 (ATP5C1) is identified by yeast two-hybrid screen
23395605 Studies indicate that F1-ATPase (F1) is a rotary motor protein driven by ATP hydrolysis and the minimum complex of F1 for function as a rotary motor is the alpha3beta3gamma subcomplex.
23125841 The interaction of HIV-1 CA with human cellular ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 (ATP5C1) is identified by yeast two-hybrid screen
23125841 The interaction of HIV-1 CA with human cellular ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 (ATP5C1) is identified by yeast two-hybrid screen
23125841 The interaction of HIV-1 CA with human cellular ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 (ATP5C1) is identified by yeast two-hybrid screen
23125841 The interaction of HIV-1 CA with human cellular ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 (ATP5C1) is identified by yeast two-hybrid screen
20877624 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
17686786 A report on the mechanism of exon skipping regulated by Fox-1, using the hF1gamma gene as a model system.
More...

AA Sequence

MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYG      1 - 70
LGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGI     71 - 140
LYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVA    141 - 210
SADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQ    211 - 280
AVITKELIEIISGAAALD                                                        281 - 298
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23395605 2013 Chemomechanical coupling mechanism of F(1)-ATPase: catalysis and torque generation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
More...