Property Summary

NCBI Gene PubMed Count 28
PubMed Score 3.84
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 2.1e-04
Multiple myeloma 1332 7.2e-04
lung cancer 4740 6.2e-03
Waldenstrons macroglobulinemia 765 1.4e-02
Breast cancer 3577 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.600 2.6e-02
lung cancer 1.100 6.2e-03
Multiple myeloma 1.701 7.2e-04
ovarian cancer -1.400 2.1e-04
Waldenstrons macroglobulinemia 1.343 1.4e-02

Gene RIF (9)

AA Sequence

MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYG      1 - 70
LGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGI     71 - 140
LYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVA    141 - 210
SADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQ    211 - 280
AVITKELIEIISGAAALD                                                        281 - 298
//

Text Mined References (34)

PMID Year Title