Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
Funding $30,409
PubMed Score 16.76
PubTator Score 23.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P36537 A8K9M3 B4DPP1 Q14CR8 UDPGT 2B10
Symbols UDPGT2B10

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (14)

PMID Text
26669329 Spatial features influence the potency of UGT2B10 inhibition.
25233931 UGT2B10 variant allele carriers had increased levels of C-oxidation (P = 0.0099)and all pathways should be considered when characterizing the role of nicotine metabolism on smoking behavior and cancer risk.
24192532 CYP2A6 and UGT2B10 genotype explain 53% of the variance in oral nicotine glucuronidation. They are also significantly associated with undeuterated (D0) nicotine glucuronidation in individuals smoking ad libitum.
23611809 the substrate specificity of UGT2B10, highlighting its preference for tertiary amines with higher affinities and clearance values than those of UGT1A4 and UGT1A3.
22228205 UGT2B17 and UGT2B10 play key roles in the glucuronidation of 3HC in the human liver and that functional polymorphisms in UGT2B17 and UGT2B10 are associated with significantly reduced glucuronidation activities against 3HC.
20876810 Data suggest that UGTs 2B10 and 2B17 play important roles in the glucuronidation of nicotine and suggest that the UGT2B10 codon 67 SNP and the UGT2B17 gene deletion reduce overall glucuronidation rates of nicotine and its major metabolites in smokers.
20876810 Observational study of gene-disease association. (HuGE Navigator)
20799965 Data show that UGT2B10 predicts MD independently of age, hormone therapy and parity.
20501767 UGT2B10 genotype influences nicotine metabolism and should be taken into account when characterizing the role of nicotine metabolism on smoking.
20501767 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSST      1 - 70
LKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQ     71 - 140
ESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERV    141 - 210
KNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLH    211 - 280
CKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNT    281 - 350
RLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMS    351 - 420
STDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSL    421 - 490
DVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD                                    491 - 528
//

Text Mined References (22)

PMID Year Title
26669329 2016 Human UDP-Glucuronosyltransferase (UGT) 2B10: Validation of Cotinine as a Selective Probe Substrate, Inhibition by UGT Enzyme-Selective Inhibitors and Antidepressant and Antipsychotic Drugs, and Structural Determinants of Enzyme Inhibition.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
25233931 2014 Nicotine N-glucuronidation relative to N-oxidation and C-oxidation and UGT2B10 genotype in five ethnic/racial groups.
24192532 2013 The contribution of common UGT2B10 and CYP2A6 alleles to variation in nicotine glucuronidation among European Americans.
23611809 2013 Human UDP-glucuronosyltransferase (UGT) 2B10 in drug N-glucuronidation: substrate screening and comparison with UGT1A3 and UGT1A4.
22228205 2012 Glucuronidation of trans-3'-hydroxycotinine by UGT2B17 and UGT2B10.
20876810 2010 Glucuronidation genotypes and nicotine metabolic phenotypes: importance of functional UGT2B10 and UGT2B17 polymorphisms.
20799965 2010 Expression levels of uridine 5'-diphospho-glucuronosyltransferase genes in breast tissue from healthy women are associated with mammographic density.
20501767 2010 UGT2B10 genotype influences nicotine glucuronidation, oxidation, and consumption.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...