Property Summary

NCBI Gene PubMed Count 19
PubMed Score 19.51
PubTator Score 23.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count P-value
non diabetic and post-ischemic heart failure 200 9.3e-03
psoriasis 6694 1.7e-02

Expression

  Differential Expression (2)

Disease log2 FC p
non diabetic and post-ischemic heart fai... 1.500 9.3e-03
psoriasis -1.400 1.7e-02

Gene RIF (14)

AA Sequence

MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSST      1 - 70
LKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQ     71 - 140
ESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERV    141 - 210
KNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLH    211 - 280
CKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNT    281 - 350
RLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMS    351 - 420
STDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSL    421 - 490
DVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD                                    491 - 528
//

Text Mined References (22)

PMID Year Title