Property Summary

NCBI Gene PubMed Count 152
Grant Count 62
R01 Count 43
Funding $3,352,986.52
PubMed Score 56.99
PubTator Score 108.58

Knowledge Summary

Patent (23,171)

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.168 0.005
psoriasis 1.200 0.001
osteosarcoma 1.001 0.011
juvenile dermatomyositis -1.028 0.000
COPD -1.100 0.006
ovarian cancer 1.900 0.000

Synonym

Accession P36507 MAP kinase kinase 2
Symbols CFC4
MEK2
MKK2
MAPKK2
PRKMK2

Gene

PDB

4H3Q   1S9I  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (116)

PMID Text
27098723 the purpose of this paper was to investigate MAPK downstream signalling molecules in Natural killer cell phenotypes from Chronic Fatigue Syndrome/Myalgic Encephalomyelitis patients.
26858456 Endocytosis separates EGF receptors from endogenous fluorescently labeled HRas and diminishes receptor signaling to MAP kinases in endosomes.
26625317 Data show that mitogen-activated protein kinase kinases MEK1/2 inhibitor pimasertib (MEKI) sensitized the cells to apoptosis through its ability to promote a G1 cell cycle arrest.
26163823 MEK1 levels are upregulated at transcriptional level whereas MEK2 levels are downregulated at posttranslational level.
26155939 at clinically relevant concentrations, cDDP binds to and inhibits MEK1/2 and both the binding and inhibitory activity are related to its interaction with Cu bound to MEK1/2
26078274 MK2 attenuates dendritic cell-mediated Th1 differentiation and autoimmune encephalomyelitis.
25722381 MEK1/2 inhibitor trametinib showed similar PFS and a response rate as docetaxel in patients with previously treated KRAS-mutant-positive non-small cell lung carcinoma.
25487361 We report on a fourth familial case with transmission of CFC syndrome from father to son due to a novel heterozygous sequence change c.376A>G (p.N126D) in exon 3 of MEK2 gene.
25463315 We documented three novel mutations in the BRAF gene in cardio-facio-cutaneous syndrome patients and correlated clinical findings with causative mutations in the BRAF or MEK1/MEK2 genes
25425646 CCR7 can also promote survival of mDCs through a novel MEK1/2-ERK1/2-AMPK signaling axis.
More...

AA Sequence

MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDD      1 - 70
DFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSD     71 - 140
GEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKL    141 - 210
CDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKELEAIFG    211 - 280
RPVVDGEEGEPHSISPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCL    281 - 350
IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV                        351 - 400
//

Text Mined References (163)

PMID Year Title
27098723 2016 ERK1/2, MEK1/2 and p38 downstream signalling molecules impaired in CD56 dim CD16+ and CD56 bright CD16 dim/- natural killer cells in Chronic Fatigue Syndrome/Myalgic Encephalomyelitis patients.
26858456 2016 Endocytosis separates EGF receptors from endogenous fluorescently labeled HRas and diminishes receptor signaling to MAP kinases in endosomes.
26625317 2016 Synergistic cooperation between ABT-263 and MEK1/2 inhibitor: effect on apoptosis and proliferation of acute myeloid leukemia cells.
26163823 2015 ERK1/2 can feedback-regulate cellular MEK1/2 levels.
26155939 2015 Cisplatin inhibits MEK1/2.
26078274 2015 The MAPK-Activated Kinase MK2 Attenuates Dendritic Cell-Mediated Th1 Differentiation and Autoimmune Encephalomyelitis.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25722381 2015 A randomized phase II study of the MEK1/MEK2 inhibitor trametinib (GSK1120212) compared with docetaxel in KRAS-mutant advanced non-small-cell lung cancer (NSCLC)†.
25600339 2015 Tunable-combinatorial mechanisms of acquired resistance limit the efficacy of BRAF/MEK cotargeting but result in melanoma drug addiction.
25487361 2015 Familial cardiofaciocutaneous syndrome in a father and a son with a novel MEK2 mutation.
More...