Property Summary

NCBI Gene PubMed Count 21
Grant Count 14
R01 Count 2
Funding $1,647,335.58
PubMed Score 2.12
PubTator Score 12.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma 2.099 0.000
astrocytoma -1.100 0.006
glioblastoma -1.200 0.050
medulloblastoma, large-cell -1.400 0.000
sarcoidosis 1.100 0.031
group 3 medulloblastoma -1.200 0.020
progressive supranuclear palsy -1.300 0.049
ovarian cancer -2.100 0.000

Gene RIF (4)

PMID Text
25905670 TRIM23 regulates adipocyte differentiation via stabilization of the adipogenic activator PPARgamma2.
20724660 conclude that TRIM23-mediated ubiquitin conjugation to NEMO is essential for TLR3- and RIG-I/MDA5-mediated antiviral innate and inflammatory responses
19176615 The authors present a novel role for TRIM23 that is specific to UL144-mediated activation of NF-kappaB during the course of virus infection.
15684077 Data are consistent with a potential function for ADP-ribosylation factor domain protein 1 as an E3 ubiquitin ligase in cells.

AA Sequence

MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAI      1 - 70
RCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESIIRCDEDEAHLASVYCT     71 - 140
VCATHLCSECSQVTHSTKTLAKHRRVPLADKPHEKTMCSQHQVHAIEFVCLEEGCQTSPLMCCVCKEYGK    141 - 210
HQGHKHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVGIVQHIEGGEQIVEDGIGMAHTEHVPGT    211 - 280
AENARSCIRAYFYDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDD    281 - 350
CRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTI    351 - 420
LFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEA    421 - 490
HSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDW    491 - 560
LSRQLVAAGVLDVA                                                            561 - 574
//

Text Mined References (21)

PMID Year Title
25905670 2015 The E3 ubiquitin ligase TRIM23 regulates adipocyte differentiation via stabilization of the adipogenic activator PPAR?.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20724660 2010 Polyubiquitin conjugation to NEMO by triparite motif protein 23 (TRIM23) is critical in antiviral defense.
19176615 2009 Identification of TRIM23 as a cofactor involved in the regulation of NF-kappaB by human cytomegalovirus.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15684077 2005 E3 ubiquitin ligase activity of the trifunctional ARD1 (ADP-ribosylation factor domain protein 1).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331580 2001 The tripartite motif family identifies cell compartments.
10982851 2000 Identification of lysosomal and Golgi localization signals in GAP and ARF domains of ARF domain protein 1.
10748148 2000 Specific functional interaction of human cytohesin-1 and ADP-ribosylation factor domain protein (ARD1).
9671726 1998 Localization of ADP-ribosylation factor domain protein 1 (ARD1) in lysosomes and Golgi apparatus.
9446556 1998 Molecular characterization of the GTPase-activating domain of ADP-ribosylation factor domain protein 1 (ARD1).
9312116 1997 Characterization of a GDP dissociation inhibitory region of ADP-ribosylation factor domain protein ARD1.
8700863 1996 ARD1, a 64-kDa bifunctional protein containing an 18-kDa GTP-binding ADP-ribosylation factor domain and a 46-kDa GTPase-activating domain.
8473324 1993 ARD 1, a 64-kDa guanine nucleotide-binding protein with a carboxyl-terminal ADP-ribosylation factor domain.