Property Summary

NCBI Gene PubMed Count 21
Grant Count 14
R01 Count 2
Funding $1,647,335.58
PubMed Score 2.12
PubTator Score 12.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma 2.099 0.000
astrocytoma -1.100 0.006
glioblastoma -1.200 0.050
medulloblastoma, large-cell -1.400 0.000
sarcoidosis 1.100 0.031
group 3 medulloblastoma -1.200 0.020
progressive supranuclear palsy -1.300 0.049
ovarian cancer -2.100 0.000

Gene RIF (4)

PMID Text
25905670 TRIM23 regulates adipocyte differentiation via stabilization of the adipogenic activator PPARgamma2.
20724660 conclude that TRIM23-mediated ubiquitin conjugation to NEMO is essential for TLR3- and RIG-I/MDA5-mediated antiviral innate and inflammatory responses
19176615 The authors present a novel role for TRIM23 that is specific to UL144-mediated activation of NF-kappaB during the course of virus infection.
15684077 Data are consistent with a potential function for ADP-ribosylation factor domain protein 1 as an E3 ubiquitin ligase in cells.

AA Sequence

MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAI      1 - 70
RCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESIIRCDEDEAHLASVYCT     71 - 140
VCATHLCSECSQVTHSTKTLAKHRRVPLADKPHEKTMCSQHQVHAIEFVCLEEGCQTSPLMCCVCKEYGK    141 - 210
HQGHKHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVGIVQHIEGGEQIVEDGIGMAHTEHVPGT    211 - 280
AENARSCIRAYFYDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDD    281 - 350
CRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTI    351 - 420
LFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEA    421 - 490
HSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDW    491 - 560
LSRQLVAAGVLDVA                                                            561 - 574
//

Text Mined References (21)

PMID Year Title
25905670 2015 The E3 ubiquitin ligase TRIM23 regulates adipocyte differentiation via stabilization of the adipogenic activator PPAR?.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20724660 2010 Polyubiquitin conjugation to NEMO by triparite motif protein 23 (TRIM23) is critical in antiviral defense.
19176615 2009 Identification of TRIM23 as a cofactor involved in the regulation of NF-kappaB by human cytomegalovirus.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...