Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.87
PubTator Score 12.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.100 5.8e-03
glioblastoma -1.200 5.0e-02
group 3 medulloblastoma -1.200 2.0e-02
medulloblastoma, large-cell -1.400 2.6e-04
osteosarcoma 2.099 2.1e-05
ovarian cancer -2.100 1.1e-12
progressive supranuclear palsy -1.300 4.9e-02
psoriasis 1.300 8.5e-04
sarcoidosis 1.100 3.1e-02

Gene RIF (5)

AA Sequence

MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAI      1 - 70
RCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESIIRCDEDEAHLASVYCT     71 - 140
VCATHLCSECSQVTHSTKTLAKHRRVPLADKPHEKTMCSQHQVHAIEFVCLEEGCQTSPLMCCVCKEYGK    141 - 210
HQGHKHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVGIVQHIEGGEQIVEDGIGMAHTEHVPGT    211 - 280
AENARSCIRAYFYDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDD    281 - 350
CRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTI    351 - 420
LFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEA    421 - 490
HSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDW    491 - 560
LSRQLVAAGVLDVA                                                            561 - 574
//

Text Mined References (25)

PMID Year Title