Property Summary

NCBI Gene PubMed Count 34
Grant Count 24
R01 Count 20
Funding $1,625,907.32
PubMed Score 33.34
PubTator Score 23.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.166 0.018
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.200 0.001
lung cancer -1.100 0.007
active Crohn's disease 1.071 0.007
adult high grade glioma -1.600 0.000
subependymal giant cell astrocytoma -1.023 0.022
ovarian cancer 1.700 0.002

Gene RIF (9)

PMID Text
27048653 These results indicate that ARL3 interacts with STAT3 and regulates the transcriptional activation of STAT3 by influencing its nuclear accumulation of STAT3.
26964041 De Novo Occurrence of a Variant in ARL3 and Apparent Autosomal Dominant Transmission of Retinitis Pigmentosa.
23548655 Arl3 acts negatively in ciliogenesis but positively in cilia signaling (Review).
22960633 When Arl3 binds UNC119, it allosterically displaces cargo by accelerating its release by 3 orders of magnitude. The N-terminal amphipathic helix of Arl3.GppNHp is not displaced by the interswitch toggle but remains bound on the surface of the protein.
22002721 The G proteins Arl3 acts in a GTP-dependent manner as allosteric release factors for farnesylated cargo.
20106869 We propose that RP2 regulation of Arl3 is important for maintaining Golgi cohesion, facilitating the transport and docking of vesicles and thereby carrying proteins to the base of the photoreceptor connecting cilium for transport to the outer segment.
18588884 Arl2 and Arl3 interactions were characterized.
16525022 Knockdown of Arl3 by siRNA resulted in changes in cell morphology, increased acetylation of alpha-tubulin, failure of cytokinesis, and increased number of binucleated cells.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGG      1 - 70
QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIA     71 - 140
EGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK                                141 - 182
//

Text Mined References (42)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27048653 2016 A New STAT3-binding Partner, ARL3, Enhances the Phosphorylation and Nuclear Accumulation of STAT3.
26964041 2016 De Novo Occurrence of a Variant in ARL3 and Apparent Autosomal Dominant Transmission of Retinitis Pigmentosa.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23548655 2013 Molecular views of Arf-like small GTPases in cilia and ciliopathies.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22960633 2012 Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
More...