Property Summary

NCBI Gene PubMed Count 36
PubMed Score 33.33
PubTator Score 24.65

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.200 9.7e-05

Gene RIF (16)

AA Sequence

MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQ      1 - 70
KSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIRE     71 - 140
VLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD                              141 - 184
//

Text Mined References (43)

PMID Year Title