Property Summary

NCBI Gene PubMed Count 32
Grant Count 15
R01 Count 10
Funding $805,808
PubMed Score 30.93
PubTator Score 24.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.200 0.000

Gene RIF (12)

PMID Text
24911211 We hypothesize that ARL2 plays essential roles inside mitochondria along with other cellular functions, at least in part to provide coupling of regulation between these essential cell processes.
23807224 MiR-195 regulates cell apoptosis in a context-dependent manner through directly targeting ARL2.
22002721 The G proteins Arl2 acts in a GTP-dependent manner as allosteric release factors for farnesylated cargo.
21199864 a novel function of miR-16 targeting ARL2 in modulating proliferation and cell cycle progression.
20740604 Data show that bovine and human TBCD have functionally identical roles in tubulin heterodimer assembly, and that the inability of human TBCD to disrupt microtubule integrity can be overcome by siRNA-mediated suppression of expression of Arl2.
19368893 Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector.
18818514 Arl2 could, via protein phosphatase 2A , influence p53 phosphorylation status.
18588884 Arl2 and Arl3 interactions were characterized.
17704193 ARL2 and beta-tubulin cofactor D participate in AJC disassembly and epithelial depolarization
17188265 In summary, alterations in Arl2 protein content were found to be associated with modifications in tubulin pools, microtubule dynamics as well as cell cycle progression.
More...

AA Sequence

MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQ      1 - 70
KSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIRE     71 - 140
VLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD                              141 - 184
//

Text Mined References (38)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
24911211 2014 The ARL2 GTPase is required for mitochondrial morphology, motility, and maintenance of ATP levels.
23807224 2013 MicroRNA-195 targets ADP-ribosylation factor-like protein 2 to induce apoptosis in human embryonic stem cell-derived neural progenitor cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22002721 2011 Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
More...