Property Summary

NCBI Gene PubMed Count 68
Grant Count 18
R01 Count 7
Funding $1,136,088.9
PubMed Score 39.63
PubTator Score 86.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma -1.194 0.001
esophageal adenocarcinoma 1.300 0.018
pancreatic ductal adenocarcinoma liver m... 1.470 0.004
sarcoidosis -1.100 0.000
non-inflammatory breast cancer -1.200 0.001

Gene RIF (40)

PMID Text
26642437 Tcf7 levels are lower in islets taken from patients with type 2 diabetes. Knockdown of TCF7 in islets impairs the cytoprotective responsiveness to GIP and enhances the magnitude of apoptotic injury.
26289446 TCF7 plays critical roles in lung diseases [review]
26079538 Findings indicate that breast cancer cells with a hyperactive AF1q/TCF7/CD44 regulatory axis in the primary sites may represent "metastatic founder cells" which have invasive properties.
25869100 Capsaicin-induced apoptosis in pancreatic cancer cells was associated with inhibition of beta-catenin signaling due to the dissociation of beta-catenin/TCF-1 complex and the process was orchestrated by STAT-3.
25842979 induction of expression activates the Wnt signaling pathway, leading to priming of liver cancer stem cells self-renewal and tumor propagation
25738174 RUNX2 signaling pathways with their partners TCF7 and FGFR1/2 may not be involved in CCD pathogenesis
25436980 we show that TCF7 is a direct target of miR-34a in prostate cancer that has metastasized to the bone
25143352 Results suggest ivermectin as therapeutic WNT protein-TCF transcription factor pathway response blocker to treat WNT-TCF-dependent diseases including multiple cancers.
24551047 miRNAs inhibited the expression of the luciferase reporter constructs containing 3'UTRs of these genes and downregulated protein expression of TERT and the TCF7 transcription factor, which mediates the canonical Wnt pathway.
23966864 we establish that ATF2 family members physically and functionally interact with TCF1/LEF1 factors to promote target gene expression and hematopoietic tumor cell growth
More...

AA Sequence

MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPG      1 - 70
VPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQH     71 - 140
PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTV    141 - 210
SWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYM    211 - 280
KEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSR    281 - 350
EKHQESTTETNWPRELKDGNGQESLSMSSSSSPA                                        351 - 384
//

Text Mined References (69)

PMID Year Title
27447672 2016 TCF/LEF Transcription Factors: An Update from the Internet Resources.
26642437 2016 TCF1 links GIPR signaling to the control of beta cell function and survival.
26379372 2015 Transcriptional Regulatory Network for the Development of Innate Lymphoid Cells.
26289446 2015 Roles of transcriptional factor 7 in production of inflammatory factors for lung diseases.
26079538 2015 AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis.
25869100 2015 Inhibition of ?-catenin signaling suppresses pancreatic tumor growth by disrupting nuclear ?-catenin/TCF-1 complex: critical role of STAT-3.
25842979 2015 The long noncoding RNA lncTCF7 promotes self-renewal of human liver cancer stem cells through activation of Wnt signaling.
25738174 2015 Expression of RUNX2 and its signaling partners TCF7, FGFR1/2 in cleidocranial dysplasia.
25678599 2015 The Tumor-Suppressor WWOX and HDAC3 Inhibit the Transcriptional Activity of the ?-Catenin Coactivator BCL9-2 in Breast Cancer Cells.
25665079 2015 Transcriptional regulation of innate and adaptive lymphocyte lineages.
More...