Property Summary

NCBI Gene PubMed Count 70
PubMed Score 44.78
PubTator Score 86.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Crohn Disease 45 0.0 0.0
Lupus Erythematosus, Systemic 67 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma 1.300 1.8e-02
inflammatory breast cancer -1.100 1.0e-03
Multiple myeloma -1.194 1.5e-03
pancreatic ductal adenocarcinoma liver m... 1.470 4.2e-03
sarcoidosis -1.100 1.1e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (42)

AA Sequence

MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPG      1 - 70
VPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQH     71 - 140
PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTV    141 - 210
SWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYM    211 - 280
KEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSR    281 - 350
EKHQESTTETNWPRELKDGNGQESLSMSSSSSPA                                        351 - 384
//

Text Mined References (71)

PMID Year Title