Property Summary

NCBI Gene PubMed Count 34
PubMed Score 186.19
PubTator Score 75.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAP      1 - 70
LSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEEDNEEDPMM     71 - 140
YPEMELESDKENKEQSQPKPKHDGRRRIREDGLMKIYVLQLLARTVFEVGFLIGQYFLYGFQVHPFYVCS    141 - 210
RLPCPHKIDCFISRPTEKTIFLLIMYGVTGLCLLLNIWEMLHLGFGTIRDSLNSKRRELEDPGAYNYPFT    211 - 280
WNTPSAPPGYNIAVKPDQIQYTELSNAKIAYKQNKANTAQEQQYGSHEENLPADLEALQREIRMAQERLD    281 - 350
LAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI                            351 - 396
//

Text Mined References (35)

PMID Year Title