Tbio | Gap junction gamma-1 protein |
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Alternatively spliced transcript variants encoding the same isoform have been described. [provided by RefSeq, Jul 2008]
This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Alternatively spliced transcript variants encoding the same isoform have been described. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Hypertensive disease | 193 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Heart disease | 279 | 4.229 | 2.1 |
Oculodentodigital dysplasia | 14 | 3.822 | 1.9 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA EggNOG |
PMID | Text |
---|---|
25401181 | Connexin45 has much more rapid gating kinetics than connexin43 |
24788723 | Results found that the expression of Cx26 and Cx45 had no prognostic value but Cx43 was upregulated in tumour epithelia and membrane Cx43 expression was associated with short overall survival time. |
21674053 | Gap junctional intercellular communication in human bladder smooth muscle cells and suburothelial myofibroblastsdepend of Cx43 rather than on Cx45. |
21424225 | Study shows that fusion of a V5/6-His tag (hexa moiety M r = 0.93 kDa) to the CT segment of Cx40, Cx43 and Cx45 does not prevent the cells from forming channels. |
21406965 | DNA hypermethylation of the promoter region of GJC1, encoding connexin45, is an important mechanism in silencing gene expression in colorectal cancer. |
21254920 | Our data suggest that GJA7 alterations have no or low genetic relevance in nonsyndromic hearing loss in populatins from Turkey, South Africa, United Kingdom, United States, and China. |
20979653 | connexin genes Gjd2 coding for mCx36, Gjc1 coding for mCx45 and Gja10 coding for mCx57 in the mouse, a subset of 4 connexin genes, including the unique GJA9 (Cx59) and GJA10 (Cx62), could be detected at least as transcript isoforms in the human retina. |
20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
20530971 | Results show that Cx40, Cx37, Cx43 and Cx45 were expressed within the glomeruli. |
19913121 | Observational study of gene-disease association. (HuGE Navigator) |
More... |
MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAP 1 - 70 LSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEEDNEEDPMM 71 - 140 YPEMELESDKENKEQSQPKPKHDGRRRIREDGLMKIYVLQLLARTVFEVGFLIGQYFLYGFQVHPFYVCS 141 - 210 RLPCPHKIDCFISRPTEKTIFLLIMYGVTGLCLLLNIWEMLHLGFGTIRDSLNSKRRELEDPGAYNYPFT 211 - 280 WNTPSAPPGYNIAVKPDQIQYTELSNAKIAYKQNKANTAQEQQYGSHEENLPADLEALQREIRMAQERLD 281 - 350 LAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI 351 - 396 //
PMID | Year | Title |
---|---|---|
25401181 | 2014 | Alterations in gap junction connexin43/connexin45 ratio mediate a transition from quiescence to excitation in a mathematical model of the myometrium. |
24788723 | 2014 | Membrane connexin 43 acts as an independent prognostic marker in oral squamous cell carcinoma. |
23348765 | 2013 | Novel germline GJA5/connexin40 mutations associated with lone atrial fibrillation impair gap junctional intercellular communication. |
21674053 | 2011 | Cytokine effects on gap junction communication and connexin expression in human bladder smooth muscle cells and suburothelial myofibroblasts. |
21424225 | 2011 | Influence of v5/6-His tag on the properties of gap junction channels composed of connexin43, connexin40 or connexin45. |
21406965 | 2011 | DNA methylation analyses of the connexin gene family reveal silencing of GJC1 (Connexin45) by promoter hypermethylation in colorectal cancer. |
21357845 | 2011 | The cardiac conduction system. |
21254920 | 2011 | Mutation screening of the GJA7 (Cx45) gene in a large international series of probands with nonsyndromic hearing impairment. |
20979653 | 2010 | Expression of connexin genes in the human retina. |
20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. |
More... |