Property Summary

NCBI Gene PubMed Count 32
Grant Count 114
R01 Count 88
Funding $10,691,572.94
PubMed Score 174.80
PubTator Score 75.74

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P36383 B3KW68 Q4VAY0
Symbols CX45
GJA7

Gene

PANTHER Protein Class (2)

PDB

3SHW  

Gene RIF (18)

PMID Text
25401181 Connexin45 has much more rapid gating kinetics than connexin43
24788723 Results found that the expression of Cx26 and Cx45 had no prognostic value but Cx43 was upregulated in tumour epithelia and membrane Cx43 expression was associated with short overall survival time.
21674053 Gap junctional intercellular communication in human bladder smooth muscle cells and suburothelial myofibroblastsdepend of Cx43 rather than on Cx45.
21424225 Study shows that fusion of a V5/6-His tag (hexa moiety M r = 0.93 kDa) to the CT segment of Cx40, Cx43 and Cx45 does not prevent the cells from forming channels.
21406965 DNA hypermethylation of the promoter region of GJC1, encoding connexin45, is an important mechanism in silencing gene expression in colorectal cancer.
21254920 Our data suggest that GJA7 alterations have no or low genetic relevance in nonsyndromic hearing loss in populatins from Turkey, South Africa, United Kingdom, United States, and China.
20979653 connexin genes Gjd2 coding for mCx36, Gjc1 coding for mCx45 and Gja10 coding for mCx57 in the mouse, a subset of 4 connexin genes, including the unique GJA9 (Cx59) and GJA10 (Cx62), could be detected at least as transcript isoforms in the human retina.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20530971 Results show that Cx40, Cx37, Cx43 and Cx45 were expressed within the glomeruli.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAP      1 - 70
LSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEEDNEEDPMM     71 - 140
YPEMELESDKENKEQSQPKPKHDGRRRIREDGLMKIYVLQLLARTVFEVGFLIGQYFLYGFQVHPFYVCS    141 - 210
RLPCPHKIDCFISRPTEKTIFLLIMYGVTGLCLLLNIWEMLHLGFGTIRDSLNSKRRELEDPGAYNYPFT    211 - 280
WNTPSAPPGYNIAVKPDQIQYTELSNAKIAYKQNKANTAQEQQYGSHEENLPADLEALQREIRMAQERLD    281 - 350
LAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI                            351 - 396
//

Text Mined References (33)

PMID Year Title
25401181 2014 Alterations in gap junction connexin43/connexin45 ratio mediate a transition from quiescence to excitation in a mathematical model of the myometrium.
24788723 2014 Membrane connexin 43 acts as an independent prognostic marker in oral squamous cell carcinoma.
23348765 2013 Novel germline GJA5/connexin40 mutations associated with lone atrial fibrillation impair gap junctional intercellular communication.
21674053 2011 Cytokine effects on gap junction communication and connexin expression in human bladder smooth muscle cells and suburothelial myofibroblasts.
21424225 2011 Influence of v5/6-His tag on the properties of gap junction channels composed of connexin43, connexin40 or connexin45.
21406965 2011 DNA methylation analyses of the connexin gene family reveal silencing of GJC1 (Connexin45) by promoter hypermethylation in colorectal cancer.
21357845 2011 The cardiac conduction system.
21254920 2011 Mutation screening of the GJA7 (Cx45) gene in a large international series of probands with nonsyndromic hearing impairment.
20979653 2010 Expression of connexin genes in the human retina.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...