Property Summary

NCBI Gene PubMed Count 18
PubMed Score 76.62
PubTator Score 12.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.575 5.5e-05
Astrocytoma, Pilocytic 1.200 4.7e-05
malignant mesothelioma -1.400 6.7e-06
osteosarcoma -2.502 4.9e-04
pancreatic cancer 1.100 9.7e-03
primary pancreatic ductal adenocarcinoma 1.637 3.3e-03

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MARGYGATVSLVLLGLGLALAVIVLAVVLSRHQAPCGPQAFAHAAVAADSKVCSDIGRAILQQQGSPVDA      1 - 70
TIAALVCTSVVNPQSMGLGGGVIFTIYNVTTGKVEVINARETVPASHAPSLLDQCAQALPLGTGAQWIGV     71 - 140
PGELRGYAEAHRRHGRLPWAQLFQPTIALLRGGHVVAPVLSRFLHNSILRPSLQASTLRQLFFNGTEPLR    141 - 210
PQDPLPWPALATTLETVATEGVEVFYTGRLGQMLVEDIAKEGSQLTLQDLAKFQPEVVDALEVPLGDYTL    211 - 280
YSPPPPAGGAILSFILNVLRGFNFSTESMARPEGRVNVYHHLVETLKFAKGQRWRLGDPRSHPKLQNASR    281 - 350
DLLGETLAQLIRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRT    351 - 420
GIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGA    421 - 490
GGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNV    491 - 560
VQAVSQEGACVYAVSDLRKSGEAAGY                                                561 - 586
//

Text Mined References (22)

PMID Year Title