Property Summary

NCBI Gene PubMed Count 17
Grant Count 20
R01 Count 18
Funding $2,518,027.5
PubMed Score 73.93
PubTator Score 12.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
osteosarcoma -2.502 0.000
adrenocortical carcinoma -1.575 0.000
primary pancreatic ductal adenocarcinoma 1.637 0.003
pilocytic astrocytoma 1.200 0.000
pancreatic cancer 1.100 0.010

Gene RIF (3)

PMID Text
25377544 Report different pattern of expression of GGT1 and GGT5 in normal human tissues.
24847614 There is a significant association of GGT with individual metabolic syndrome components, except HDL and inflammatory parameters (hs-CRP, ferritin).
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of gamma-glutamyltransferase 5 (GGT5) in primary human brain microvascular endothelial cells

AA Sequence

MARGYGATVSLVLLGLGLALAVIVLAVVLSRHQAPCGPQAFAHAAVAADSKVCSDIGRAILQQQGSPVDA      1 - 70
TIAALVCTSVVNPQSMGLGGGVIFTIYNVTTGKVEVINARETVPASHAPSLLDQCAQALPLGTGAQWIGV     71 - 140
PGELRGYAEAHRRHGRLPWAQLFQPTIALLRGGHVVAPVLSRFLHNSILRPSLQASTLRQLFFNGTEPLR    141 - 210
PQDPLPWPALATTLETVATEGVEVFYTGRLGQMLVEDIAKEGSQLTLQDLAKFQPEVVDALEVPLGDYTL    211 - 280
YSPPPPAGGAILSFILNVLRGFNFSTESMARPEGRVNVYHHLVETLKFAKGQRWRLGDPRSHPKLQNASR    281 - 350
DLLGETLAQLIRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRT    351 - 420
GIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGA    421 - 490
GGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNV    491 - 560
VQAVSQEGACVYAVSDLRKSGEAAGY                                                561 - 586
//

Text Mined References (21)

PMID Year Title
25377544 2015 Immunolabeling of gamma-glutamyl transferase 5 in normal human tissues reveals that expression and localization differ from gamma-glutamyl transferase 1.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24847614 2014 Gamma-glutamyl transpeptidase level associated with metabolic syndrome and proinflammatory parameters in the young Roma population in eastern Slovakia: a population-based study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23624525 2013 Genome-wide association analyses in Han Chinese identify two new susceptibility loci for amyotrophic lateral sclerosis.
21447318 2011 Gamma-glutamyl compounds: substrate specificity of gamma-glutamyl transpeptidase enzymes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18357469 2008 The human gamma-glutamyltransferase gene family.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...