Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1598.61
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P36268 GGT 2
Symbols GGT
GGT 2

Gene

PANTHER Protein Class (2)

Gene RIF (19)

PMID Text
25280803 The serum GGT level was associated with brachial-ankle pulse wave velocity, a marker of peripheral atherosclerosis, independently of covariates including fatty liver or menopausal state just in women, but not in men.
25180444 In stable coronary artery disease, increased GGT activity within the normal range is associated with increased oxidative stress.
23682772 hGGT2 does not encode a functional enzyme; microarray data which have reported induction of hGGT2 mRNA should not be interpreted as induction of a protein that has a role in the metabolism of extracellular glutathione and in maintaining the redox status
23138005 In a Korean population, increased GGT serum concentration is associated with increased cardiovascular disease risk.
22749559 Fraction pattern analysis might increase the specificity of GGT as biomarker of alcohol abuse, especially in the context of differential diagnosis between alcoholism and non-alcoholic liver disease.
22269385 expression of GGT2 gene is closely regulated by the ERK signal pathway in 267B1/K-RAS cells.
21986103 High gamma-Glutamyltransferase is associated with arterial stiffness.
21375200 results indicate that levels of GGT were raised with increased waist girth, BMI, blood pressure TG and low HDL in patients with type 2 diabetes
20622017 Analysis of hepatic GGT glycopeptides revealed 11 glycan compositions, with 12 unique structures, none of which were observed on kidney GGT. Two glycosylation sites on renal GGT were modified exclusively by neutral glycans.
19670414 Ultrasonographic hepatic steatosis increases prediction of mortality risk from elevated serum gamma-glutamyl transpeptidase levels.
More...

AA Sequence

MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAMAADAKQCLEIGRDTLRDGGSAVDAAIA      1 - 70
ALLCVGLMNAHSMGIGVGLFLTIYNSTTGKAEVINAREVAPRLAFASMFNSSEQSQKGGLSVAVPGEIRG     71 - 140
YELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAVLENKRTVIEQQPVLWYVFCRDRKVLREGERLTL    141 - 210
PRLADTYEMLAIEGAQAFYNGSLMAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAR    211 - 280
LSGPVLALILNILKGYNFSRESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFF    281 - 350
AAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNE    351 - 420
WTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLW    421 - 490
FGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAALDS    491 - 560
RKGGEPAGY                                                                 561 - 569
//

Text Mined References (25)

PMID Year Title
25280803 2014 Association between serum ?-glutamyltranspeptidase and atherosclerosis: a population-based cross-sectional study.
25180444 2015 Gamma glutamyl transferase activity is independently associated with oxidative stress rather than SYNTAX score.
23682772 2013 Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23138005 2012 Serum gamma-glutamyltransferase as a risk factor for general cardiovascular disease prediction in Koreans.
22749559 2013 High-sensitivity ?-glutamyltransferase fraction pattern in alcohol addicts and abstainers.
22269385 2012 K-RAS transformation in prostate epithelial cell overcomes H2O2-induced apoptosis via upregulation of gamma-glutamyltransferase-2.
21986103 2012 Association between ?-glutamyltransferase, adiponectin and arterial stiffness.
21375200 2010 Comparison of gamma glutamyltransferase in normal and in type 2 diabetics.
20622017 2010 Analysis of site-specific glycosylation of renal and hepatic ?-glutamyl transpeptidase from normal human tissue.
More...