| Tbio | Chitinase-3-like protein 1 |
Carbohydrate-binding lectin with a preference for chitin. Has no chitinase activity. May play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation. Facilitates invasion of pathogenic enteric bacteria into colonic mucosa and lymphoid organs. Mediates activation of AKT1 signaling pathway and subsequent IL8 production in colonic epithelial cells. Regulates antibacterial responses in lung by contributing to macrophage bacterial killing, controlling bacterial dissemination and augmenting host tolerance. Also regulates hyperoxia-induced injury, inflammation and epithelial apoptosis in lung.
Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling. [provided by RefSeq, Sep 2009]
Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling. [provided by RefSeq, Sep 2009]
Comments
| Disease | Target Count |
|---|---|
| ASTHMA-RELATED TRAITS, SUSCEPTIBILITY TO, 7 | 1 |
| Degenerative polyarthritis | 93 |
| Glioma | 66 |
| Neoplasm Invasiveness | 127 |
| glioblastoma | 5572 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Obstructive lung disease | 1 | 0.0 | 2.0 |
| Disease | Target Count |
|---|---|
| Schizophrenia | 503 |
| Disease | Target Count |
|---|---|
| Asthma-related traits 7 | 1 |
| Species | Source |
|---|---|
| Chimp | OMA EggNOG |
| Macaque | OMA Inparanoid |
| Mouse | OMA EggNOG Inparanoid |
| Rat | OMA Inparanoid |
| Dog | OMA EggNOG Inparanoid |
| Cow | OMA EggNOG Inparanoid |
| Opossum | OMA EggNOG Inparanoid |
| Platypus | OMA EggNOG Inparanoid |
| S.cerevisiae | OMA Inparanoid |
| PMID | Text |
|---|---|
| 27152377 | serum YKL-40 level in coronary artery disease patients was significantly higher than that in control subjects. |
| 27121858 | Increased mRNA level of CHI3L1 could be associated with the progression of astrocytoma and poor patient survival not only for glioblastoma, but for lower grade astrocytoma tumors as well. |
| 27069189 | We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases. |
| 27013031 | YKL-40 expression is up-regulated in patients with COPD and correlates with exacerbation attacks and may contribute to airway remodeling by acting on lung fibroblasts. |
| 26828595 | Elevated serum CHI3L1 concentration is an independent prognostic biomarker for poorer survival in lung cancer patients. |
| 26733160 | This review comprehensively analyzes recent data about expression pattern, and involvement of human YKL-40, YKL-39 and SI-CLP in cancer. [review] |
| 26698298 | Neurogranin and YKL-40 are promising AD biomarkers, independent of and complementary to the established core Alzheimer's disease (AD) biomarkers, reflecting additional pathological changes in the course of AD |
| 26696093 | YKL-40 is a potential marker for in vitro cultured pro-inflammatory macrophages and is not a valuable biomarker in serum and sputum of patients with COPD treated with inhaled corticosteroids. |
| 26620310 | Ykl-40 expression was significantly lower in the serum of TB patients compared to lung cancer, lung metastasis, pneumonia, and transudate pleural effusion. Pleural Ykl40 was similar among all groups. |
| 26603717 | The serum YKL-40 cutoff to identify beta-thalassemia major patients with liver cirrhosis or heart disease was determined. |
| More... |
MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWE 1 - 70 WNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWL 71 - 140 YPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHG 141 - 210 AWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISG 211 - 280 PGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAM 281 - 350 VWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT 351 - 383 //
| PMID | Year | Title |
|---|---|---|
| 27152377 | 2016 | Diagnostic Value of Serum YKL-40 Level for Coronary Artery Disease: A Meta-Analysis. |
| 27121858 | 2016 | High CHI3L1 expression is associated with glioma patient survival. |
| 27069189 | 2016 | Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study. |
| 27013031 | 2016 | YKL-40 expression in chronic obstructive pulmonary disease: relation to acute exacerbations and airway remodeling. |
| 26828595 | 2016 | Elevated Serum Concentration of Chitinase 3-Like 1 is an Independent Prognostic Biomarker for Poor Survival in Lung Cancer Patients. |
| 26733160 | 2016 | Role of chitinase-like proteins in cancer. |
| 26698298 | 2015 | Neurogranin and YKL-40: independent markers of synaptic degeneration and neuroinflammation in Alzheimer's disease. |
| 26696093 | 2015 | Regulation of YKL-40 expression by corticosteroids: effect on pro-inflammatory macrophages in vitro and its modulation in COPD in vivo. |
| 26620310 | 2015 | Expression of YKL-40 and MIP-1a proteins in exudates and transudates: biomarkers for differential diagnosis of pleural effusions? A pilot study. |
| 26603717 | 2016 | Serum YKL-40 in young patients with ?-thalassemia major: Relation to hepatitis C virus infection, liver stiffness by transient elastography and cardiovascular complications. |
| More... |
