Property Summary

NCBI Gene PubMed Count 287
PubMed Score 668.29
PubTator Score 667.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
lung carcinoma 2844 3.71047234952739E-16
non-small cell lung carcinoma 413 4.87129326960991E-12
ulcerative colitis 2087 1.93765530670492E-7
Breast cancer 3099 3.07878590472306E-7
posterior fossa group A ependymoma 1511 5.93840300307373E-7
lung adenocarcinoma 2714 1.83168404793777E-6
ovarian cancer 8492 2.0094473720775E-6
malignant mesothelioma 3163 4.76664090353308E-6
interstitial cystitis 2299 6.75058421899477E-6
adult high grade glioma 2148 1.80591486884439E-5
pituitary cancer 1972 4.01932277718118E-5
medulloblastoma 1524 6.64975029205659E-5
head and neck cancer 270 1.09486680107748E-4
nasopharyngeal carcinoma 1056 3.49741830155626E-4
acute quadriplegic myopathy 1157 5.36811333250589E-4
lung cancer 4473 6.29013952858811E-4
osteosarcoma 7933 8.68790568737476E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 9.96200260166843E-4
pilocytic astrocytoma 3086 0.00105821161795478
head and neck cancer and chronic obstructive pulmonary disease 237 0.00281311893091359
cystic fibrosis 1670 0.0043887820221014
limb girdle muscular dystrophy 2B 74 0.00694534108820408
colon cancer 1475 0.00777490104513564
medulloblastoma, large-cell 6234 0.00865959037153025
ductal carcinoma in situ 1745 0.0160518260374311
mucosa-associated lymphoid tissue lymphoma 480 0.0265293525528853
chronic rhinosinusitis 512 0.026680871992288
gastric carcinoma 832 0.0325053283225961
Obesity 616 0.0332186358584641
primitive neuroectodermal tumor 3031 0.0435621932947763
pterygium 74 0.0482785674094718
Disease Target Count Z-score Confidence
Obstructive lung disease 1 0.0 2.0
Disease Target Count Z-score Confidence
Asthma 349 4.091 2.0
Disease Target Count
Schizophrenia 503
Disease Target Count
Asthma-related traits 7 1

Expression

Synonym

Accession P36222 B2R7B0 P30923 Q8IVA4 Q96HI7
Symbols GP39
ASRT7
GP-39
YKL40
CGP-39
YKL-40
YYL-40
HC-gp39
HCGP-3P
hCGP-39

Gene

PANTHER Protein Class (2)

PDB

1HJV   1HJW   1HJX   1LA7   1NWR   1NWS   1NWT   1NWU  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

 GWAS Trait (1)

Gene RIF (283)

PMID Text
27152377 serum YKL-40 level in coronary artery disease patients was significantly higher than that in control subjects.
27121858 Increased mRNA level of CHI3L1 could be associated with the progression of astrocytoma and poor patient survival not only for glioblastoma, but for lower grade astrocytoma tumors as well.
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
27013031 YKL-40 expression is up-regulated in patients with COPD and correlates with exacerbation attacks and may contribute to airway remodeling by acting on lung fibroblasts.
26828595 Elevated serum CHI3L1 concentration is an independent prognostic biomarker for poorer survival in lung cancer patients.
26733160 This review comprehensively analyzes recent data about expression pattern, and involvement of human YKL-40, YKL-39 and SI-CLP in cancer. [review]
26698298 Neurogranin and YKL-40 are promising AD biomarkers, independent of and complementary to the established core Alzheimer's disease (AD) biomarkers, reflecting additional pathological changes in the course of AD
26696093 YKL-40 is a potential marker for in vitro cultured pro-inflammatory macrophages and is not a valuable biomarker in serum and sputum of patients with COPD treated with inhaled corticosteroids.
26620310 Ykl-40 expression was significantly lower in the serum of TB patients compared to lung cancer, lung metastasis, pneumonia, and transudate pleural effusion. Pleural Ykl40 was similar among all groups.
26603717 The serum YKL-40 cutoff to identify beta-thalassemia major patients with liver cirrhosis or heart disease was determined.
More...

AA Sequence

MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWE      1 - 70
WNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWL     71 - 140
YPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHG    141 - 210
AWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISG    211 - 280
PGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAM    281 - 350
VWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT                                         351 - 383
//

Text Mined References (290)

PMID Year Title
27152377 2016 Diagnostic Value of Serum YKL-40 Level for Coronary Artery Disease: A Meta-Analysis.
27121858 2016 High CHI3L1 expression is associated with glioma patient survival.
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
27013031 2016 YKL-40 expression in chronic obstructive pulmonary disease: relation to acute exacerbations and airway remodeling.
26828595 2016 Elevated Serum Concentration of Chitinase 3-Like 1 is an Independent Prognostic Biomarker for Poor Survival in Lung Cancer Patients.
26733160 2016 Role of chitinase-like proteins in cancer.
26698298 2015 Neurogranin and YKL-40: independent markers of synaptic degeneration and neuroinflammation in Alzheimer's disease.
26696093 2015 Regulation of YKL-40 expression by corticosteroids: effect on pro-inflammatory macrophages in vitro and its modulation in COPD in vivo.
26620310 2015 Expression of YKL-40 and MIP-1a proteins in exudates and transudates: biomarkers for differential diagnosis of pleural effusions? A pilot study.
26603717 2016 Serum YKL-40 in young patients with ?-thalassemia major: Relation to hepatitis C virus infection, liver stiffness by transient elastography and cardiovascular complications.
More...