Property Summary

NCBI Gene PubMed Count 326
PubMed Score 732.92
PubTator Score 667.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Degenerative polyarthritis 115
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Obstructive lung disease 1 0.0 3.0
Disease Target Count Z-score Confidence
Asthma 385 4.159 2.1

Expression

  Differential Expression (32)

Disease log2 FC p
glioblastoma 2.500 3.0e-03
acute quadriplegic myopathy 2.264 5.4e-04
adult high grade glioma 3.800 1.8e-05
Astrocytoma, Pilocytic 3.000 1.1e-03
Breast cancer -3.400 3.1e-07
chronic rhinosinusitis 2.018 2.7e-02
colon cancer 3.500 7.8e-03
cystic fibrosis 1.817 5.7e-03
ductal carcinoma in situ 2.800 1.6e-02
gastric carcinoma 3.600 3.3e-02
group 3 medulloblastoma -2.600 1.2e-02
head and neck cancer 3.000 1.1e-04
head and neck cancer and chronic obstruc... 3.100 2.8e-03
interstitial cystitis 5.500 1.9e-03
limb girdle muscular dystrophy 2B 1.039 1.7e-03
lung adenocarcinoma 1.100 4.7e-04
lung cancer -3.500 6.3e-04
lung carcinoma -2.600 3.7e-16
malignant mesothelioma -1.300 4.8e-06
medulloblastoma, large-cell -3.300 8.7e-03
mucosa-associated lymphoid tissue lympho... 2.977 2.7e-02
nasopharyngeal carcinoma 2.300 3.5e-04
non-small cell lung carcinoma 1.100 4.9e-12
Obesity 1.400 3.3e-02
osteosarcoma -4.144 8.7e-04
ovarian cancer 4.300 2.0e-06
pancreatic ductal adenocarcinoma liver m... -3.204 1.0e-02
pituitary cancer -5.000 4.0e-05
posterior fossa group A ependymoma 3.400 5.9e-07
primitive neuroectodermal tumor -2.600 4.4e-02
pterygium -1.200 4.8e-02
ulcerative colitis 5.300 1.9e-07

Gene RIF (322)

AA Sequence

MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWE      1 - 70
WNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWL     71 - 140
YPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHG    141 - 210
AWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISG    211 - 280
PGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAM    281 - 350
VWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT                                         351 - 383
//

Text Mined References (329)

PMID Year Title