Property Summary

NCBI Gene PubMed Count 287
Grant Count 124
R01 Count 71
Funding $19,643,771.75
PubMed Score 668.29
PubTator Score 667.03

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P36222 B2R7B0 P30923 Q8IVA4 Q96HI7
Symbols GP39
ASRT7
GP-39
YKL40
CGP-39
YKL-40
YYL-40
HC-gp39
HCGP-3P
hCGP-39

Gene

PANTHER Protein Class (2)

PDB

1HJV   1HJW   1HJX   1LA7   1NWR   1NWS   1NWT   1NWU  

Gene RIF (283)

PMID Text
27152377 serum YKL-40 level in coronary artery disease patients was significantly higher than that in control subjects.
27121858 Increased mRNA level of CHI3L1 could be associated with the progression of astrocytoma and poor patient survival not only for glioblastoma, but for lower grade astrocytoma tumors as well.
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
27013031 YKL-40 expression is up-regulated in patients with COPD and correlates with exacerbation attacks and may contribute to airway remodeling by acting on lung fibroblasts.
26828595 Elevated serum CHI3L1 concentration is an independent prognostic biomarker for poorer survival in lung cancer patients.
26733160 This review comprehensively analyzes recent data about expression pattern, and involvement of human YKL-40, YKL-39 and SI-CLP in cancer. [review]
26698298 Neurogranin and YKL-40 are promising AD biomarkers, independent of and complementary to the established core Alzheimer's disease (AD) biomarkers, reflecting additional pathological changes in the course of AD
26696093 YKL-40 is a potential marker for in vitro cultured pro-inflammatory macrophages and is not a valuable biomarker in serum and sputum of patients with COPD treated with inhaled corticosteroids.
26620310 Ykl-40 expression was significantly lower in the serum of TB patients compared to lung cancer, lung metastasis, pneumonia, and transudate pleural effusion. Pleural Ykl40 was similar among all groups.
26603717 The serum YKL-40 cutoff to identify beta-thalassemia major patients with liver cirrhosis or heart disease was determined.
More...

AA Sequence

MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWE      1 - 70
WNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWL     71 - 140
YPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHG    141 - 210
AWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISG    211 - 280
PGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAM    281 - 350
VWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT                                         351 - 383
//

Text Mined References (290)

PMID Year Title
27152377 2016 Diagnostic Value of Serum YKL-40 Level for Coronary Artery Disease: A Meta-Analysis.
27121858 2016 High CHI3L1 expression is associated with glioma patient survival.
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
27013031 2016 YKL-40 expression in chronic obstructive pulmonary disease: relation to acute exacerbations and airway remodeling.
26828595 2016 Elevated Serum Concentration of Chitinase 3-Like 1 is an Independent Prognostic Biomarker for Poor Survival in Lung Cancer Patients.
26733160 2016 Role of chitinase-like proteins in cancer.
26698298 2015 Neurogranin and YKL-40: independent markers of synaptic degeneration and neuroinflammation in Alzheimer's disease.
26696093 2015 Regulation of YKL-40 expression by corticosteroids: effect on pro-inflammatory macrophages in vitro and its modulation in COPD in vivo.
26620310 2015 Expression of YKL-40 and MIP-1a proteins in exudates and transudates: biomarkers for differential diagnosis of pleural effusions? A pilot study.
26603717 2016 Serum YKL-40 in young patients with ?-thalassemia major: Relation to hepatitis C virus infection, liver stiffness by transient elastography and cardiovascular complications.
More...