Property Summary

NCBI Gene PubMed Count 735
PubMed Score 4236.06
PubTator Score 2715.46

Knowledge Summary

Patent (506,465)

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.23959466253087E-18
ovarian cancer 8492 1.64124021205591E-17
malignant mesothelioma 3163 3.47482514640923E-10
lung adenocarcinoma 2714 2.72078247329212E-8
lung cancer 4473 1.28887769117842E-5
posterior fossa group A ependymoma 1511 2.47293640034009E-5
facioscapulohumeral dystrophy 286 1.40256483237349E-4
interstitial cystitis 2299 2.71052983340007E-4
ulcerative colitis 2087 0.00122047527515664
urothelial carcinoma 318 0.00245368021088739
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0108324132334989
glioblastoma 5572 0.0140921712420111
invasive ductal carcinoma 2950 0.0151914887608416
cystic fibrosis 1670 0.0172220446210886
chronic rhinosinusitis 512 0.0209281766954874
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0389852004908021
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession P35968 A2RRS0 B5A925 C5IFA0 O60723 Q14178 VEGFR-2
Symbols FLK1
CD309
VEGFR
VEGFR2

Gene

KDR

PDB

3V2A   2X1W   2X1X   1VR2   1Y6A   1Y6B   1YWN   2M59   2MET   2MEU   2OH4   2P2H   2P2I   2QU5   2QU6   2RL5   2XIR   3B8Q   3B8R   3BE2   3C7Q   3CJF   3CJG   3CP9   3CPB   3CPC   3DTW   3EFL   3EWH   3KVQ   3S35   3S36   3S37   3U6J   3V6B   3VHE   3VHK   3VID   3VNT   3VO3   3WZD   3WZE   4AG8   4AGC   4AGD   4ASD   4ASE   5EW3  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (693)

PMID Text
26981634 Meta-analysis. Our finding indicates that VEGFR polymorphism +1192C>T and +1719A>T may be associated with the risk of stroke, but not -604T>C.
26890264 increased expression of VEGF-A and VEGFR-2 mRNA in neointima compared to normal aorta; a significantly higher protein content of VEGF-A and VEGFR-2 in neointima samples compared to controls was also observed; results indicate possible involvement of VEGF-A and VEGFR-2 system in the pathologic process of neointima formation after vascular interventions
26879375 Hydrogen sulfide promotes angiogenesis by downregulating miR-640 and increasing the levels of HIF1A through the VEGFR2-mTOR pathway.
26853422 Results suggest, a potential role for PIK3CA, VEGFR2, RET and FGFR2 as therapeutic targets in EGFR non-mutated NSCLC that requires further clinical validation.
26735859 Report KDR genetic alterations in angiosarcomas.
26709129 Negative for VEGF/VEGFR2.
26655705 TLR4 knockdown inhibited VEGF signaling through VEGF receptor 2 (VEGFR2).
26653034 IL-8 rs4073 and VEGFR-2 rs2071559 genotypes may represent important molecular determinants to modulate final outcomes in neovascular age-related macular degeneration patients.
26627848 High expression of VEGFR2 is associated with astrocytomas.
26600539 KDR siRNA can significantly silence KDR gene and protein expression in A549 cells, inhibit the proliferation of A549 cells, and enhance their sensitivity to docetaxel
More...

AA Sequence

MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGS      1 - 70
EQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITE     71 - 140
NKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQ    141 - 210
SIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQ    211 - 280
SGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRI    281 - 350
PAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP    351 - 420
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVED    421 - 490
FQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQ    491 - 560
PTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELK    561 - 630
NASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMW    631 - 700
FKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVG    701 - 770
TAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL    771 - 840
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGG    841 - 910
PLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEE    911 - 980
KSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLA    981 - 1050
RDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLK   1051 - 1120
EGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDS   1121 - 1190
GLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS   1191 - 1260
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLI   1261 - 1330
EIGVQTGSTAQILQPDSGTTLSSPPV                                               1331 - 1356
//

Text Mined References (761)

PMID Year Title
26981634 2016 The Association between VEGFR Gene Polymorphisms and Stroke: A Meta-Analysis.
26890264 2016 Evaluation of Vascular Endothelial Growth Factor and Its Receptors in Human Neointima.
26879375 2016 Hydrogen sulfide promotes angiogenesis by downregulating miR-640 via the VEGFR2/mTOR pathway.
26853422 Genomic profiling in a homogeneous molecular subtype of non-small cell lung cancer: An effort to explore new drug targets.
26735859 2016 Recurrent CIC Gene Abnormalities in Angiosarcomas: A Molecular Study of 120 Cases With Concurrent Investigation of PLCG1, KDR, MYC, and FLT4 Gene Alterations.
26709129 VEGF/VEGFR2 Axis in Periodontal Disease Progression and Angiogenesis: Basic Approach for a New Therapeutic Strategy.
26655705 2016 An endothelial TLR4-VEGFR2 pathway mediates lung protection against oxidant-induced injury.
26653034 2016 IL-8 and VEGFR-2 polymorphisms modulate long-term functional response to intravitreal ranibizumab in exudative age-related macular degeneration.
26627848 2016 Differential expression of vascular endothelial growth factor A, its receptors VEGFR-1, -2, and -3 and co-receptors neuropilin-1 and -2 does not predict bevacizumab response in human astrocytomas.
26600539 2015 KDR gene silencing inhibits proliferation of A549 cells and enhances their sensitivity to docetaxel.
More...