Property Summary

Ligand Count 1,659
NCBI Gene PubMed Count 817
PubMed Score 4544.83
PubTator Score 2715.46

Knowledge Summary

Patent (506,465)

TINX Plot

  Disease (7)

Disease Target Count
Angiosarcoma 11

Expression

  Differential Expression (16)

Disease log2 FC p
lung cancer -2.300 2.3e-05
chronic rhinosinusitis 1.160 2.1e-02
cystic fibrosis -1.300 1.7e-02
facioscapulohumeral dystrophy -2.500 1.4e-04
glioblastoma 1.200 1.4e-02
interstitial cystitis 1.200 2.7e-04
intraductal papillary-mucinous carcinoma... -1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-02
invasive ductal carcinoma -1.100 1.5e-02
lung adenocarcinoma -1.300 2.7e-08
malignant mesothelioma -7.100 3.5e-10
non-small cell lung cancer -1.048 3.3e-05
ovarian cancer -5.400 1.6e-17
posterior fossa group A ependymoma 1.100 2.5e-05
ulcerative colitis 1.200 1.2e-03
urothelial carcinoma 1.700 2.5e-03

Synonym

Accession P35968 A2RRS0 B5A925 C5IFA0 O60723 Q14178 VEGFR-2
Symbols FLK1
CD309
VEGFR
VEGFR2

Gene

KDR

PDB

3V2A   2X1W   2X1X   1VR2   1Y6A   1Y6B   1YWN   2M59   2MET   2MEU   2OH4   2P2H   2P2I   2QU5   2QU6   2RL5   2XIR   3B8Q   3B8R   3BE2   3C7Q   3CJF   3CJG   3CP9   3CPB   3CPC   3DTW   3EFL   3EWH   3KVQ   3S35   3S36   3S37   3U6J   3V6B   3VHE   3VHK   3VID   3VNT   3VO3   3WZD   3WZE   4AG8   4AGC   4AGD   4ASD   4ASE   5EW3  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (772)

AA Sequence

MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGS      1 - 70
EQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITE     71 - 140
NKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQ    141 - 210
SIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQ    211 - 280
SGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRI    281 - 350
PAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP    351 - 420
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVED    421 - 490
FQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQ    491 - 560
PTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELK    561 - 630
NASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMW    631 - 700
FKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVG    701 - 770
TAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL    771 - 840
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGG    841 - 910
PLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEE    911 - 980
KSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLA    981 - 1050
RDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLK   1051 - 1120
EGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDS   1121 - 1190
GLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS   1191 - 1260
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLI   1261 - 1330
EIGVQTGSTAQILQPDSGTTLSSPPV                                               1331 - 1356
//

Text Mined References (842)

PMID Year Title