Property Summary

NCBI Gene PubMed Count 202
Grant Count 195
R01 Count 137
Funding $18,516,400.52
PubMed Score 499.02
PubTator Score 414.41

Knowledge Summary

Patent (116,835)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -2.145 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.300 0.000

Synonym

Accession P35916 A8K6L4 B5A926 Q16067 Q86W07 Q86W08 VEGFR-3
Symbols PCL
FLT-4
FLT41
LMPH1A
VEGFR3
VEGFR-3

Gene

PDB

4BSK   4BSJ  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (169)

PMID Text
27066737 this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role.
26735859 Report FLT4 genetic alterations in angiosarcomas.
26714373 Case Reports: novel FLT4 gene mutation in a Chinese family with Milroy disease.
26706909 The most extensively accepted signaling pathways promoting lymphangiogenesis in tumors include the secreted lymphangiogenic proteins: VEGF-C and VEGF-D, and their cognate receptor on lymphatic endothelium VEGF receptor-3 (VEGFR-3).
26543080 MTA1 is up-regulated in CRC; its expression is inversely associated with lymphatic metastases and the expression of VEGFC, VEGFD and VEGFR3
26394830 High expression levels of VEGFR1 and VEGFR3 were associated with a higher rate of lung metastasis.
26121315 VEGFR-3 is a new target to improve net ultrafiltration in methylglyoxal-induced peritoneal injury by suppressing lymphatic absorption
26091406 our findings contribute to the putative targets in which the FLT4 gene mutation was found to have a significant role in lymphatic filariasis, while FOXC2 and FLT4 SNP interactions need to be further elucidated at a functional level.
26091405 A Novel Missense Mutation in FLT4 Causes Autosomal Recessive Hereditary Lymphedema
25909285 Data indicate that foretinib suppresses angiogenesis and lymphangiogenesis by blocking vascular endothelial growth factor receptors
More...

AA Sequence

MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPAT      1 - 70
GDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFI     71 - 140
NKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTW    141 - 210
GDQDFLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVP    211 - 280
ERRSQQTHTELSSILTIHNVSQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDE    281 - 350
LVKLPVKLAAYPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV    351 - 420
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQDLMPQCRDWR    421 - 490
AVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIYFYVTTIPDGFTI    491 - 560
ESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCKNVHLFATPLAASLEEVAPG    561 - 630
ARHATLSLSIPRVAPEHEGHYVCEVQDRRSHDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCL    631 - 700
VAGAHAPSIVWYKDERLLEEKSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSED    701 - 770
KGSMEIVILVGTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF    771 - 840
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKILIHIGNHLNVV    841 - 910
NLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRFRAMVELARLDRRRPGSSDRV    911 - 980
LFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQVARGMEFLASRKCIHRDLAARNILLSESDV    981 - 1050
VKICDFGLARDIYKDPDYVRKGSARLPLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQI   1051 - 1120
NEEFCQRLRDGTRMRAPELATPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRS   1121 - 1190
SQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM   1191 - 1260
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRRRPERGARGGQ   1261 - 1330
VFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY                                        1331 - 1363
//

Text Mined References (215)

PMID Year Title
27066737 2016 Pathological lymphangiogenesis is modulated by galectin-8-dependent crosstalk between podoplanin and integrin-associated VEGFR-3.
26735859 2016 Recurrent CIC Gene Abnormalities in Angiosarcomas: A Molecular Study of 120 Cases With Concurrent Investigation of PLCG1, KDR, MYC, and FLT4 Gene Alterations.
26714373 2015 A NOVEL FLT4 GENE MUTATION AND MR LYMPHANGIOGRAPHY IN A CHINESE FAMILY WITH MILROY DISEASE.
26706909 2016 IGFBP7 functions as a potential lymphangiogenesis inducer in non-small cell lung carcinoma.
26543080 MTA1 Is Up-regulated in Colorectal Cancer and Is Inversely Correlated with Lymphatic Metastasis.
26394830 2015 Angiogenesis-related protein expression in bevacizumab-treated metastatic colorectal cancer: NOTCH1 detrimental to overall survival.
26121315 2015 Vascular endothelial growth factor receptor-3 is a novel target to improve net ultrafiltration in methylglyoxal-induced peritoneal injury.
26091406 2015 FOXC2 and FLT4 Gene Variants in Lymphatic Filariasis.
26091405 2015 A Novel Missense Mutation in FLT4 Causes Autosomal Recessive Hereditary Lymphedema.
25909285 2015 Foretinib inhibits angiogenesis, lymphangiogenesis and tumor growth of pancreatic cancer in vivo by decreasing VEGFR-2/3 and TIE-2 signaling.
More...