Property Summary

NCBI Gene PubMed Count 42
PubMed Score 88.27
PubTator Score 112.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
colon cancer -1.100 3.1e-03
psoriasis 1.300 5.7e-04

Protein-protein Interaction (5)

Gene RIF (22)

AA Sequence

MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSV      1 - 70
IETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNIN     71 - 140
CSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAKVAEVTKKFYSMGCYEISLGDTIGVGT    141 - 210
PGIMKDMLSAVMQEVPLAALAVHCHDTYGQALANTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATED    211 - 280
LVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL                             281 - 325
//

Text Mined References (53)

PMID Year Title