Property Summary

Ligand Count 1
NCBI Gene PubMed Count 43
PubMed Score 507.43
PubTator Score 145.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
posterior fossa group B ependymoma 416 2.8e-06
inflammatory breast cancer 286 2.4e-03
fibroadenoma 559 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
fibroadenoma 1.100 2.7e-02
inflammatory breast cancer -1.300 2.4e-03
posterior fossa group B ependymoma 1.100 2.8e-06

Protein-protein Interaction (1)

Gene RIF (17)

AA Sequence

MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEESTALLELVQDMQESI      1 - 70
NMERVVFKVLRRLCTLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLEDCLVPPDSEIVFPLDIGVVG     71 - 140
HVAQTKKMVNVEDVAECPHFSSFADELTDYKTKNMLATPIMNGKDVVAVIMAVNKLNGPFFTSEDEDVFL    141 - 210
KYLNFATLYLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDM    211 - 280
TKEKEFFDVWSVLMGESQPYSGPRTPDGREIVFYKVIDYVLHGKEEIKVIPTPSADHWALASGLPSYVAE    281 - 350
SGFICNIMNASADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMES    351 - 420
LTQFLGWSVMNTDTYDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRARLGKEPADCDEDELGEILK    421 - 490
EELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEVLVRFLFSISKGYRRITYHNWR    491 - 560
HGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDIDHRGTNNLYQMKSQNPLAKLHGSSILERHHL    561 - 630
EFGKFLLSEETLNIYQNLNRRQHEHVIHLMDIAIIATDLALYFKKRAMFQKIVDESKNYQDKKSWVEYLS    631 - 700
LETTRKEIVMAMMMTACDLSAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKL    701 - 770
QVGFIDFVCTFVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEKEEEERVAAKKVGTEIC    771 - 840
NGGPAPKSSTCCIL                                                            841 - 854
//

Text Mined References (45)

PMID Year Title