Property Summary

Ligand Count 56
NCBI Gene PubMed Count 459
PubMed Score 0.00
PubTator Score 2095.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Adenocarcinoma of lung 142 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Atherosclerosis 291 0.0 0.0
Atrophy 10 0.0 0.0
Birth Weight 13 0.0 0.0
Bone Resorption 8 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Cardiomegaly 116 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Chronobiology Disorders 3 0.0 0.0
Dermatitis, Contact 71 0.0 0.0
Dyslipidemias 27 0.0 0.0
Growth Disorders 35 0.0 0.0
Heart Defects, Congenital 37 0.0 0.0
Hepatomegaly 285 0.0 0.0
Hyperoxia 3 0.0 0.0
Hyperpigmentation 37 0.0 0.0
Hypertension 396 0.0 0.0
Hypertrophy 17 0.0 0.0
Hypertrophy, Left Ventricular 24 0.0 0.0
Hyperventilation 6 0.0 0.0
Infertility, Male 46 0.0 0.0
Inflammation 120 0.0 0.0
Insulin Resistance 72 0.0 0.0
Liver diseases 87 0.0 0.0
Liver neoplasms 130 0.0 0.0
Lung Injury 20 0.0 0.0
Metabolic Diseases 10 0.0 0.0
Necrosis 53 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasms 63 0.0 0.0
Neoplasms, Experimental 40 0.0 0.0
Nystagmus, Congenital 2 0.0 0.0
Obesity 678 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Pancreatic cancer, adult 1 0.0 0.0
Peanut Hypersensitivity 1 0.0 0.0
Pneumonia 174 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Silicosis 12 0.0 0.0
Splenic Diseases 3 0.0 0.0
Splenomegaly 190 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Tachycardia 43 0.0 0.0
Tobacco Use Disorder 12 0.0 0.0
Ureteral Neoplasms 1 0.0 0.0
Urinary Bladder Calculi 1 0.0 0.0
Vascular Diseases 16 0.0 0.0
Weight Gain 100 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.8
substance-related disorder 162 0.0 3.0

Expression

  Differential Expression (20)

Disease log2 FC p
active ulcerative colitis 1.491 1.7e-02
acute myeloid leukemia 1.200 5.1e-03
aldosterone-producing adenoma -1.215 1.1e-02
Astrocytoma, Pilocytic 2.700 6.8e-14
Breast cancer -1.500 5.3e-08
cystic fibrosis -1.539 9.0e-05
diabetes mellitus -1.100 7.8e-03
gastric carcinoma 1.100 1.6e-02
Hydrolethalus syndrome 1.778 3.9e-02
intraductal papillary-mucinous neoplasm ... 2.100 4.2e-02
lung cancer -2.000 1.5e-04
lung carcinoma -2.300 1.4e-32
malignant mesothelioma -1.300 1.9e-05
medulloblastoma, large-cell -1.200 1.4e-05
osteosarcoma 1.559 2.9e-02
ovarian cancer 1.500 4.5e-03
pancreatic cancer 1.300 5.2e-04
pancreatic carcinoma 1.300 5.2e-04
pediatric high grade glioma 1.300 1.1e-02
primary pancreatic ductal adenocarcinoma 1.663 6.7e-03

Gene RIF (413)

AA Sequence

MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVL      1 - 70
RLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASS     71 - 140
TIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPP    141 - 210
ENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEI    211 - 280
RTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIV    281 - 350
FRLLTKNNRWTWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF    351 - 420
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAPFENNFFNESM    421 - 490
NECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLYSIMKNLGIDFEDIRHMQNEK    491 - 560
FFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQQQQSLALNSSCMVQEHLHLEQQQQHHQKQV    561 - 630
VVEPQQQLCQKMKHMQVNGMFENWNSNQFVPFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNF    631 - 700
ISCNQPVLPQHSKCTELDYPMGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVS    701 - 770
MYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP    771 - 840
DLTSSGFL                                                                  841 - 848
//

Text Mined References (462)

PMID Year Title