Property Summary

NCBI Gene PubMed Count 403
PubMed Score 0.00
PubTator Score 2095.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (66)

Disease Z-score Confidence
Adenocarcinoma of lung (disorder) 48
Allergy to peanuts 1
Arthritis, Experimental 39
Atherosclerosis 275
Atrophic 10
Bone Resorption 7
Breast cancer 3,094
Cardiomegaly 66
Chronobiology Disorders 3
Congenital Heart Defects 37
Congenital nystagmus 26
Contact Dermatitis 80
Drug-Induced Liver Injury 118
Dyslipidemias 17
Growth Disorders 33
Hydrolethalus syndrome 128
Hyperoxia 3
Hypertensive disease 193
Hyperventilation 2
Inflammation 109
Insulin Resistance 48
Left Ventricular Hypertrophy 24
Liver diseases 66
Liver neoplasms 109
Lung Injury 20
Male infertility 170
Mammary Neoplasms 410
Metabolic Diseases 9
Necrosis 51
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Neoplasms, Experimental 33
Pancreatic Neoplasm 79
Pancreatic cancer, adult 1
Peripheral Neuropathy 303
Pneumonia 133
Prostatic Neoplasms 471
Rheumatoid Arthritis 1,160
Silicosis 10
Splenic Diseases 3
Splenomegaly 7
Stomach Neoplasms 282
Tachycardia 17
Tobacco Use Disorder 10
Ureteral Neoplasms 1
Urinary Bladder Calculi (disorder) 1
Vascular Diseases 16
acute myeloid leukemia 780
aldosterone-producing adenoma 664
cystic fibrosis 1,665
diabetes mellitus 1,663
gastric carcinoma 832
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primary pancreatic ductal adenocarcinoma 1,271
substance-related disorder 105 2.0
ulcerative colitis 2,087

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer 1.300 0.001
malignant mesothelioma -1.300 0.000
osteosarcoma 1.559 0.029
cystic fibrosis -1.539 0.000
medulloblastoma, large-cell -1.200 0.000
primary pancreatic ductal adenocarcinoma 1.663 0.007
intraductal papillary-mucinous neoplasm ... 2.100 0.042
Hydrolethalus syndrome 1.778 0.039
lung cancer -2.300 0.000
ulcerative colitis 1.500 0.000
diabetes mellitus -1.100 0.008
pediatric high grade glioma 1.300 0.011
pilocytic astrocytoma 2.800 0.000
pancreatic carcinoma 1.300 0.001
aldosterone-producing adenoma -1.215 0.011
lung carcinoma -2.300 0.000
Breast cancer -1.500 0.000
gastric carcinoma 1.100 0.016
acute myeloid leukemia 1.200 0.005
ovarian cancer 1.500 0.004

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
2796 screening 7990 / 0 / 316868 Luminescence-based primary cell-based high throughput screening assay to identify activators of the Aryl Hydrocarbon Receptor (AHR)
2804 summary 0 / 0 / 0 Summary of probe development efforts to identify activators of the Aryl Hydrocarbon Receptor (AHR)
2845 screening 1982 / 0 / 299 Luminescence-based cell-based high throughput confirmation assay for activators of the Aryl Hydrocarbon Receptor (AHR)
463088 confirmatory 113 / 0 / 13 Luminescence-based cell-based high throughput dose response assay for activators of the Aryl Hydrocarbon Receptor (AHR)
493060 confirmatory 32 / 0 / 1 Late stage results for the probe development effort to identify activators of the Aryl Hydrocarbon Receptor (AHR): Luminescence-based cell-based dose response assay for AHR activators
602171 other 33 / 0 / 0 Late stage assay provider counterscreen for the probe development effort to identify activators of the Aryl Hydrocarbon Receptor (AHR): Luminescence-based Human Hepatoma (HG2L7.5c1) Cell-based assay to identify activators of AhR
602172 confirmatory 13 / 0 / 20 Late stage assay provider counterscreen for activators of Aryl hydrocarbon receptor (AHR): Radiometric electrophoretic mobility shift assay (EMSA) to identify compounds that enhance formation of AHR:DRE (dioxin response element) complexes in vitro
602226 other 5 / 0 / 1 Late stage assay provider counterscreen for activators of Aryl hydrocarbon receptor (AHR): Radiometric [3H]TCDD Competitive Binding assay to identify compounds that inhibit binding of radiolabeled TCDD to AHR in cytosol isolated from guinea pig liver
624401 confirmatory 8 / 0 / 17 Late stage assay provider counterscreen for the probe development effort to identify activators of the Aryl Hydrocarbon Receptor (AHR): Luminescence-based Human Hepatoma (HG2L7.5c1) Cell-based assay to identify activators of AhR, Set 2
624402 other 9 / 0 / 16 Late stage assay provider dose-response counterscreen for activators of Aryl hydrocarbon receptor (AhR): Radiometric electrophoretic mobility shift assay (EMSA) to identify compounds that stimulate AhR transformation and binding to its specific DNA recognition site in vitro

Gene RIF (357)

PMID Text
27121842 MSI2 directly attenuates aryl hydrocarbon receptor (AHR) signalling through post-transcriptional downregulation of canonical AHR pathway components in cord blood haematopoietic stem and progenitor cells
26984638 AHR plays an important role in development of cells with cancer stem cell-like qualities and that environmental AHR ligands may exacerbate breast cancer by enhancing expression of these properties.
26966070 These results suggest that ARPE-19 cells possess an AHR-mediated transcription pathway with different target gene specificity, and that BRG1 is required for AHR-mediated transcription in ARPE-19 cells.
26944194 Proliferation of breast cancer cells is dependent on the expression of both LAT1 and AHR.
26776670 the AhR-G1661A transition may affect AhR-transactivation domain interaction.
26727491 Ligand specificity and selection may be determined not only by the PAS-B domain, but also by AhR other parts and its protein interacting partners. Ligand binding pocket and access channels leading to it discriminate endogenous molecules and xenobiotics.
26715507 Results determined that constitutive AhR expression coupled to BRCA-1 promoter CpG hypermethylation may be predictive markers of ERalpha-negative breast tumor development.
26662408 Lack of association between the aryl hydrocarbon receptor rs2066853 polymorphism and breast cancer
26601943 In the human liver samples a significant inverse association was observed between the miR-378 and AhR protein levels.
26514676 This study evaluated the expression of FGF7, AhR, and CYP1A1 in colorectal cancer cells and revealed a new mechanism by which KGF promotes cell proliferation through the AhR-cyclin D1 pathway in colon cancer cells.
More...

AA Sequence

MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVL      1 - 70
RLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASS     71 - 140
TIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPP    141 - 210
ENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEI    211 - 280
RTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIV    281 - 350
FRLLTKNNRWTWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF    351 - 420
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAPFENNFFNESM    421 - 490
NECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLYSIMKNLGIDFEDIRHMQNEK    491 - 560
FFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQQQQSLALNSSCMVQEHLHLEQQQQHHQKQV    561 - 630
VVEPQQQLCQKMKHMQVNGMFENWNSNQFVPFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNF    631 - 700
ISCNQPVLPQHSKCTELDYPMGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVS    701 - 770
MYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP    771 - 840
DLTSSGFL                                                                  841 - 848
//

Text Mined References (406)

PMID Year Title
27121842 2016 Musashi-2 attenuates AHR signalling to expand human haematopoietic stem cells.
26984638 2016 The role of the aryl hydrocarbon receptor in the development of cells with the molecular and functional characteristics of cancer stem-like cells.
26966070 2016 Regulation of aryl hydrocarbon receptor-mediated transcription in human retinal pigmented epithelial cells.
26944194 2016 Aryl hydrocarbon receptor (AHR) regulation of L-Type Amino Acid Transporter 1 (LAT-1) expression in MCF-7 and MDA-MB-231 breast cancer cells.
26776670 2016 An in silico approach to investigate the source of the controversial interpretations about the phenotypic results of the human AhR-gene G1661A polymorphism.
26727491 2016 Access Path to the Ligand Binding Pocket May Play a Role in Xenobiotics Selection by AhR.
26715507 2015 Constitutive expression of AhR and BRCA-1 promoter CpG hypermethylation as biomarkers of ER?-negative breast tumorigenesis.
26662408 2015 Lack of association between the aryl hydrocarbon receptor rs2066853 polymorphism and breast cancer: A meta-analysis on Ahr polymorphism and breast cancer.
26601943 2016 RNA Editing Modulates Human Hepatic Aryl Hydrocarbon Receptor Expression by Creating MicroRNA Recognition Sequence.
26514676 2016 Keratinocyte Growth Factor Regulation of Aryl Hydrocarbon Receptor Activation in Colorectal Cancer Cells.
More...