Property Summary

Ligand Count 1
NCBI Gene PubMed Count 51
PubMed Score 48.69
PubTator Score 49.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.900 4.9e-06
astrocytic glioma -1.500 2.6e-02
Astrocytoma, Pilocytic -1.200 3.9e-05
atypical teratoid / rhabdoid tumor -2.100 5.7e-08
Breast cancer -1.100 3.2e-08
colon cancer -1.200 2.1e-02
ductal carcinoma in situ -1.100 4.8e-04
ependymoma -1.400 3.3e-08
glioblastoma -1.500 4.6e-07
group 4 medulloblastoma 1.200 1.5e-03
invasive ductal carcinoma -1.300 7.5e-03
medulloblastoma, large-cell -1.700 3.4e-05
osteosarcoma 2.891 7.2e-08
ovarian cancer -1.700 1.0e-06
pancreatic ductal adenocarcinoma liver m... -1.441 1.3e-03
Pick disease 1.900 4.0e-07
pituitary cancer 1.100 1.7e-06
psoriasis 1.100 2.8e-04
sarcoidosis 1.300 3.6e-03
spina bifida -1.123 3.7e-02
subependymal giant cell astrocytoma -1.772 4.9e-02
ulcerative colitis -1.121 2.5e-03

Protein-protein Interaction (4)

Gene RIF (25)

AA Sequence

MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKY      1 - 70
CCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY     71 - 140
FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGP    141 - 210
TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGS    211 - 280
RDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGE    281 - 350
LASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW                                          351 - 382
//

Text Mined References (59)

PMID Year Title