Property Summary

NCBI Gene PubMed Count 46
Grant Count 19
R01 Count 15
Funding $1,433,530.64
PubMed Score 44.29
PubTator Score 49.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.500 0.026
psoriasis 1.100 0.000
glioblastoma -2.200 0.000
osteosarcoma -3.312 0.000
ependymoma -1.400 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -1.700 0.000
ulcerative colitis -1.121 0.003
pancreatic ductal adenocarcinoma liver m... -1.441 0.001
colon cancer -1.200 0.021
sarcoidosis 1.300 0.004
adult high grade glioma -1.900 0.000
group 4 medulloblastoma 1.200 0.001
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.772 0.049
spina bifida -1.431 0.037
Pick disease 1.900 0.000
Breast cancer -1.100 0.000
ductal carcinoma in situ -1.100 0.000
invasive ductal carcinoma -1.300 0.008
ovarian cancer -1.700 0.000
pituitary cancer 1.100 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
624438 confirmatory 0 / 0 / 1 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP2C-alpha (Round 5)

Gene RIF (20)

PMID Text
25815785 findings demonstrate a novel regulatory circuit in which STING and TBK1 reciprocally regulate each other to enable efficient antiviral signaling activation, and PPM1A dephosphorylates STING and TBK1
25026293 Loss of PPM1A is associated with the development of tumor invasion in bladder cancer patients.
24901250 The TGF-beta/Smad signaling system decreases its activity through strong negative regulation. We provide evidence for a new negative feedback loop through PPM1A upregulation.
23906386 phosphatase activity toward phosphopeptide substrates by PP2Calpha and Wip1 requires the binding of a Mg(2)+ ion to the low-affinity site.
23812431 PPM1A is a RelA phosphatase that regulates NF-kappaB activity and that PPM1A has tumor suppressor-like activity.
23779087 a nuclear envelope-localized mechanism of inactivating TGF-beta signaling in which MAN1 competes with transcription factors for binding to Smad2 and Smad3 and facilitates their dephosphorylation by PPM1A.
23560844 PPM1A negatively regulates ERK by directly dephosphorylating its pThr202 position early in epidermal growth factor stimulation. Additional kinetic studies reveal that key residues participate in phospho-ERK recognition by PPM1A.
22727189 PPM1A inhibits HIV-1 infection and gene expression. PPM1A depletion in resting CD4+ T cells increases HIV-1 gene expression.
22727189 Knockdown of protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A) by siRNA ehnahces HIV-1 gene expression in resting CD4+ T cells
22519956 Studies indicate that phosphatase PPM1G is a component of the spliceosome and binds to protein YB-1 to affect alternative splicing.
More...

AA Sequence

MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKY      1 - 70
CCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY     71 - 140
FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGP    141 - 210
TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGS    211 - 280
RDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGE    281 - 350
LASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW                                          351 - 382
//

Text Mined References (54)

PMID Year Title
25815785 2015 PPM1A regulates antiviral signaling by antagonizing TBK1-mediated STING phosphorylation and aggregation.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25026293 2014 Loss of PPM1A expression enhances invasion and the epithelial-to-mesenchymal transition in bladder cancer by activating the TGF-?/Smad signaling pathway.
24901250 2014 The self-limiting dynamics of TGF-? signaling in silico and in vitro, with negative feedback through PPM1A upregulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23906386 2013 Binding of a third metal ion by the human phosphatases PP2C? and Wip1 is required for phosphatase activity.
23812431 2014 PPM1A is a RelA phosphatase with tumor suppressor-like activity.
23779087 2013 Inhibition of TGF-? signaling at the nuclear envelope: characterization of interactions between MAN1, Smad2 and Smad3, and PPM1A.
23560844 2013 Metal-dependent protein phosphatase 1A functions as an extracellular signal-regulated kinase phosphatase.
22781750 2012 Protein phosphatase 5 modulates SMAD3 function in the transforming growth factor-? pathway.
More...