Property Summary

NCBI Gene PubMed Count 49
Grant Count 253
R01 Count 165
Funding $30,451,672.74
PubMed Score 267.50
PubTator Score 159.42

Knowledge Summary

Patent (30,263)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 3.300 0.000
ependymoma 1.200 0.024
esophageal adenocarcinoma 1.100 0.020
osteosarcoma -1.677 0.000
pancreatic ductal adenocarcinoma liver m... 1.041 0.034
lung cancer 1.800 0.000
Pick disease -1.400 0.000
ulcerative colitis -1.200 0.000

Synonym

Accession P35790 Q8NE29 CK
Symbols CK
EK
CHK
CKI

Gene

PANTHER Protein Class (2)

PDB

2CKO   2CKP   2CKQ   2I7Q   3F2R   3G15   3ZM9   4BR3   4CG8   4CG9   4CGA   4DA5   5AFV   5EQE   5EQP   5EQY   5FTG   5FUT  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

Gene RIF (39)

PMID Text
26769123 Study shows increased CHKA expression in pancreatic ductal adenocarcinoma tumors and may be a predictive marker of response to chemotherapy.
26657335 CHKA can act as an AR chaperone, providing, to our knowledge, the first evidence for kinases as molecular chaperones, making CHKA both a marker of tumor progression and a potential therapeutic target for PCa.
26503172 These data also support the approach of antitumor strategies that destabilize Chk-alpha protein or downregulate PtdCho in breast cancer treatment.
26496360 Downregulation of choline kinase-alpha enhances autophagy in tamoxifen-resistant breast cancer cells.
26041862 Increased expression of CHKA is seen in malignant lesions of prostate cancer
25796169 Identify choline kinase alpha as a key regulator of glutathione-dependent antioxidant cell defense in ovarian carcinoma.
25768400 Chokalpha possessed oncogenic activity and could be a potential therapeutic target in T-cell lymphoma , as well as other hematological malignancies with interrupted Ras signaling pathways
25522435 there is a role for the ChoKalpha protein in promoting cancer cell survival that is independent of its catalytic activity.
25267063 The significance of CHKA overexpression on a TMA.
25028471 choline kinase alpha is inhibited by a near-infrared fluorescent carbocyanine
More...

AA Sequence

MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAASDLESKQLGGQQPPLALPPPPPLPLPLPLP      1 - 70
QPPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGLSNMLFQCSLPDTTATLGDEP     71 - 140
RKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLESVMFAILAERSLGPKLYGIFPQGRLEQFIP    141 - 210
SRRLDTEELSLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSY    211 - 280
NLPLELENLRSLLESTPSPVVFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW    281 - 350
MYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLW    351 - 420
GLWSIVQAKISSIEFGYMDYAQARFDAYFHQKRKLGV                                     421 - 457
//

Text Mined References (51)

PMID Year Title
26769123 2016 Choline Kinase Alpha (CHK?) as a Therapeutic Target in Pancreatic Ductal Adenocarcinoma: Expression, Predictive Value, and Sensitivity to Inhibitors.
26657335 2016 Choline Kinase Alpha as an Androgen Receptor Chaperone and Prostate Cancer Therapeutic Target.
26503172 2015 Choline kinase-? protein and phosphatidylcholine but not phosphocholine are required for breast cancer cell survival.
26496360 2015 Downregulation of Choline Kinase-Alpha Enhances Autophagy in Tamoxifen-Resistant Breast Cancer Cells.
26041862 2015 Exploiting altered patterns of choline kinase-alpha expression on human prostate tissue to prognosticate prostate cancer.
25796169 2015 Global metabolic profile identifies choline kinase alpha as a key regulator of glutathione-dependent antioxidant cell defense in ovarian carcinoma.
25768400 2015 Dysregulated choline metabolism in T-cell lymphoma: role of choline kinase-? and therapeutic targeting.
25522435 2013 A non-catalytic role of choline kinase alpha is important in promoting cancer cell survival.
25267063 2014 Alterations of choline phospholipid metabolism in endometrial cancer are caused by choline kinase alpha overexpression and a hyperactivated deacylation pathway.
25028471 2014 Direct inhibition of choline kinase by a near-infrared fluorescent carbocyanine.
More...