Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.85
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (3)

PMID Text
22082156 Knockdown of zinc finger protein 93 (ZNF93) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19742314 zinc finger proteins, and ZNF93 in particular, are involved in resistance to ET-743 and PM00104

AA Sequence

MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGIVVSKPDLIAHLEQGKKPLTMKRHEM      1 - 70
VANPSVICSHFAQDLWPEQNIKDSFQKVILRRYEKRGHGNLQLIKRCESVDECKVHTGGYNGLNQCSTTT     71 - 140
QSKVFQCDKYGKVFHKFSNSNRHNIRHTEKKPFKCIECGKAFNQFSTLITHKKIHTGEKPYICEECGKAF    141 - 210
KYSSALNTHKRIHTGEKPYKCDKCDKAFIASSTLSKHEIIHTGKKPYKCEECGKAFNQSSTLTKHKKIHT    211 - 280
GEKPYKCEECGKAFNQSSTLTKHKKIHTGEKPYVCEECGKAFKYSRILTTHKRIHTGEKPYKCNKCGKAF    281 - 350
IASSTLSRHEFIHMGKKHYKCEECGKAFIWSSVLTRHKRVHTGEKPYKCEECGKAFKYSSTLSSHKRSHT    351 - 420
GEKPYKCEECGKAFVASSTLSKHEIIHTGKKPYKCEECGKAFNQSSSLTKHKKIHTGEKPYKCEECGKAF    421 - 490
NQSSSLTKHKKIHTGEKPYKCEECGKAFNQSSTLIKHKKIHTREKPYKCEECGKAFHLSTHLTTHKILHT    491 - 560
GEKPYRCRECGKAFNHSATLSSHKKIHSGEKPYECDKCGKAFISPSSLSRHEIIHTGEKP              561 - 620
//

Text Mined References (11)

PMID Year Title
25274305 2014 An evolutionary arms race between KRAB zinc-finger genes ZNF91/93 and SVA/L1 retrotransposons.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19742314 2009 ZNF93 increases resistance to ET-743 (Trabectedin; Yondelis) and PM00104 (Zalypsis) in human cancer cell lines.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8467795 1993 Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.
More...