Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.86
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.300 2.8e-02
atypical teratoid / rhabdoid tumor 1.100 1.1e-06
cystic fibrosis 1.300 3.0e-04
glioblastoma 1.300 1.6e-03
group 3 medulloblastoma 1.700 3.4e-05
lung cancer 1.800 2.0e-04
medulloblastoma, large-cell 1.200 1.8e-03
mucosa-associated lymphoid tissue lympho... -1.032 6.1e-03
non primary Sjogren syndrome sicca -1.200 2.6e-02
oligodendroglioma 1.300 4.0e-02
ovarian cancer 1.100 1.4e-08
primitive neuroectodermal tumor 1.200 3.7e-04
psoriasis -1.400 7.3e-04

Gene RIF (3)

AA Sequence

MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGIVVSKPDLIAHLEQGKKPLTMKRHEM      1 - 70
VANPSVICSHFAQDLWPEQNIKDSFQKVILRRYEKRGHGNLQLIKRCESVDECKVHTGGYNGLNQCSTTT     71 - 140
QSKVFQCDKYGKVFHKFSNSNRHNIRHTEKKPFKCIECGKAFNQFSTLITHKKIHTGEKPYICEECGKAF    141 - 210
KYSSALNTHKRIHTGEKPYKCDKCDKAFIASSTLSKHEIIHTGKKPYKCEECGKAFNQSSTLTKHKKIHT    211 - 280
GEKPYKCEECGKAFNQSSTLTKHKKIHTGEKPYVCEECGKAFKYSRILTTHKRIHTGEKPYKCNKCGKAF    281 - 350
IASSTLSRHEFIHMGKKHYKCEECGKAFIWSSVLTRHKRVHTGEKPYKCEECGKAFKYSSTLSSHKRSHT    351 - 420
GEKPYKCEECGKAFVASSTLSKHEIIHTGKKPYKCEECGKAFNQSSSLTKHKKIHTGEKPYKCEECGKAF    421 - 490
NQSSSLTKHKKIHTGEKPYKCEECGKAFNQSSTLIKHKKIHTREKPYKCEECGKAFHLSTHLTTHKILHT    491 - 560
GEKPYRCRECGKAFNHSATLSSHKKIHSGEKPYECDKCGKAFISPSSLSRHEIIHTGEKP              561 - 620
//

Text Mined References (11)

PMID Year Title