Property Summary

NCBI Gene PubMed Count 68
Grant Count 145
R01 Count 85
Funding $18,111,499.79
PubMed Score 421.71
PubTator Score 281.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35754 B2R4L2 Q3KQS1 Q6ICT1
Symbols GRX
GRX1

Gene

PANTHER Protein Class (1)

PDB

1B4Q   1JHB   4RQR  

Gene RIF (39)

PMID Text
26601956 Prx2 glutathionylation is a favorable reaction that can occur in cells under oxidative stress and may have a role in redox signaling. GSH/Grx1 provide an alternative mechanism to thioredoxin and thioredoxin reductase for Prx2 recycling.
26210445 The results demonstrate that the antiproliferative effect of NO is hampered by Trx1 and Grx1 and support the strategy of weakening the thiolic antioxidant defenses when designing new antitumoral therapies.
25788646 Glutaredoxin 1 protects human retinal pigment epithelial cells from oxidative damage by preventing AKT glutathionylation.
24816595 A new function for GRX1 in neuronal copper homeostasis and in protection from copper-mediated oxidative injury.
24522867 Human Grx1 can catalyse reduction of Atox1 by glutathione but only in the presence of Cu(I).
24482236 Glrx overexpression increased soluble VEGF receptor 1 (sFlt) in endothelial cells via NF-kappaB-dependent Wnt5a production.
24270206 Levels of GLRX in the cerebrospinal fluid increase significantly in the early stages of Alzheimer's disease.
24062305 Thioredoxin 1 is inactivated due to oxidation induced by peroxiredoxin under oxidative stress and reactivated by the glutaredoxin system.
23370801 sputum glutaredoxin-1 may have a role in asthma, while protein S may have a role in better lung function
22977247 Studies show that the glutaredoxin system with glutathione plays a backup role to keep oxidized thioredoxin 1 (Trx1) reduced in cells with loss of thioredoxin reductase 1 (TrxR1) activity.
More...

AA Sequence

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV      1 - 70
PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ                                       71 - 106
//

Text Mined References (72)

PMID Year Title
26601956 2016 Glutathionylation of the Active Site Cysteines of Peroxiredoxin 2 and Recycling by Glutaredoxin.
26210445 2015 Redox regulation of metabolic and signaling pathways by thioredoxin and glutaredoxin in NOS-3 overexpressing hepatoblastoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25788646 2015 Glutaredoxin 1 (Grx1) Protects Human Retinal Pigment Epithelial Cells From Oxidative Damage by Preventing AKT Glutathionylation.
24816595 2014 Glutaredoxin1 protects neuronal cells from copper-induced toxicity.
24522867 2014 Redox sulfur chemistry of the copper chaperone Atox1 is regulated by the enzyme glutaredoxin 1, the reduction potential of the glutathione couple GSSG/2GSH and the availability of Cu(I).
24482236 2014 Glutaredoxin-1 up-regulation induces soluble vascular endothelial growth factor receptor 1, attenuating post-ischemia limb revascularization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270206 2014 Alteration of thioredoxin and glutaredoxin in the progression of Alzheimer's disease.
24062305 2013 Thioredoxin 1 is inactivated due to oxidation induced by peroxiredoxin under oxidative stress and reactivated by the glutaredoxin system.
More...