Property Summary

NCBI Gene PubMed Count 75
PubMed Score 453.45
PubTator Score 281.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
acute myeloid leukemia -1.100 7.2e-03
acute quadriplegic myopathy 1.697 4.0e-06
adrenocortical carcinoma -1.195 1.4e-03
Amyotrophic lateral sclerosis 1.075 1.8e-05
astrocytic glioma -1.300 1.9e-02
Atopic dermatitis -1.400 9.5e-05
atypical teratoid / rhabdoid tumor -2.200 1.0e-06
Barrett's esophagus 1.200 3.5e-02
Breast cancer 1.300 2.1e-03
Chronic Lymphocytic Leukemia -2.498 1.4e-07
cutaneous lupus erythematosus 1.100 2.2e-02
cystic fibrosis 1.156 7.2e-05
dermatomyositis 1.300 5.5e-03
ependymoma -1.600 3.3e-02
esophageal adenocarcinoma 1.500 3.8e-02
glioblastoma 1.400 8.1e-03
group 3 medulloblastoma -1.400 5.3e-03
intraductal papillary-mucinous carcinoma... 1.300 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.600 6.0e-03
invasive ductal carcinoma 1.042 5.5e-03
lung cancer -1.900 2.1e-05
lung carcinoma -2.600 4.6e-21
malignant mesothelioma -1.200 2.9e-06
medulloblastoma, large-cell -2.000 2.6e-05
non-small cell lung cancer -1.459 4.3e-16
oligodendroglioma -1.700 1.0e-02
osteosarcoma -1.796 2.4e-04
ovarian cancer 1.500 3.3e-04
pancreatic ductal adenocarcinoma liver m... -1.044 1.8e-02
primitive neuroectodermal tumor -1.100 1.4e-02
psoriasis -1.500 4.4e-03
tuberculosis 1.300 2.1e-04
ulcerative colitis 1.100 1.4e-07

Protein-protein Interaction (3)

Gene RIF (46)

AA Sequence

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV      1 - 70
PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ                                       71 - 106
//

Text Mined References (79)

PMID Year Title