Property Summary

NCBI Gene PubMed Count 59
PubMed Score 415.31
PubTator Score 190.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 1.0
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Aortic aneurysm 38 3.795 1.9
Cancer 2499 0.0 4.0

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical adenoma -1.065 1.0e-02
adult high grade glioma -1.600 4.4e-04
Atopic dermatitis -1.200 6.2e-03
atypical teratoid / rhabdoid tumor -1.300 1.2e-03
Breast cancer -2.200 2.7e-02
breast carcinoma -1.900 6.1e-04
colon cancer -1.200 2.3e-02
ductal carcinoma in situ -1.300 6.8e-03
glioblastoma -1.100 7.9e-05
group 4 medulloblastoma -1.100 6.6e-03
interstitial lung disease 1.200 4.8e-02
intraductal papillary-mucinous adenoma (... -1.900 4.2e-04
intraductal papillary-mucinous carcinoma... -1.800 1.1e-03
intraductal papillary-mucinous neoplasm ... -2.000 4.8e-03
invasive ductal carcinoma -1.800 4.3e-03
lung adenocarcinoma -1.200 4.9e-08
lung cancer -2.100 5.6e-05
lung carcinoma -1.100 2.3e-05
medulloblastoma, large-cell -1.400 9.9e-04
non diabetic and post-ischemic heart fai... 1.100 1.9e-02
non-small cell lung cancer -1.593 1.6e-09
osteosarcoma -2.877 7.5e-04
Pick disease 1.500 9.6e-03
pituitary cancer 1.200 5.0e-03
primitive neuroectodermal tumor -1.100 1.7e-02
psoriasis -1.900 1.2e-04

Gene RIF (40)

AA Sequence

MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVT      1 - 70
VGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVD     71 - 140
MYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSI    141 - 210
TGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERT    211 - 280
FHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVV    281 - 350
SSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFA    351 - 420
VEALAKATYERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHT    421 - 490
MFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCTEQGSH    491 - 560
PKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQ    561 - 630
MAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLR    631 - 700
CNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFF    701 - 770
RTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTK    771 - 840
VKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELYAEAEEMR    841 - 910
VRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKI    911 - 980
KKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSR    981 - 1050
QELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHI   1051 - 1120
SDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSH   1121 - 1190
EAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQ   1191 - 1260
VQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQ   1261 - 1330
KLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKE   1331 - 1400
IENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADE   1401 - 1470
RDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQ   1471 - 1540
MEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERK   1541 - 1610
QRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEK   1611 - 1680
KAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQG   1681 - 1750
NMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEMEGAVKSKFKSTIAALE   1751 - 1820
AKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAE   1821 - 1890
EESQRINANRRKLQRELDEATESNEAMGREVNALKSKLRRGNETSFVPSRRSGGRRVIENADGSEEETDT   1891 - 1960
RDADFNGTKASE                                                             1961 - 1972
//

Text Mined References (63)

PMID Year Title