Property Summary

NCBI Gene PubMed Count 67
Grant Count 25
R01 Count 10
Funding $3,985,923.95
PubMed Score 92.35
PubTator Score 102.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 5.000 0.000
astrocytoma 2.700 0.000
ependymoma 2.000 0.012
oligodendroglioma 3.100 0.000
glioblastoma 2.700 0.039
osteosarcoma 1.904 0.039
group 4 medulloblastoma 4.200 0.000
medulloblastoma, large-cell 3.900 0.000
primitive neuroectodermal tumor 4.800 0.000
lung cancer 2.100 0.001
pancreatic cancer 1.200 0.002
pediatric high grade glioma 2.400 0.004
atypical teratoid/rhabdoid tumor 2.000 0.027
Breast cancer 2.800 0.000
ductal carcinoma in situ 3.400 0.025
ovarian cancer 1.500 0.002
psoriasis -1.600 0.000

 GO Component (2)

Gene RIF (52)

PMID Text
26543203 SOX11 deletion or mutation can present with a Coffin-Siris phenotype
26505998 The ability of sox11 to reduce effector caspase activity was also reflected in its capacity to reduce cell death following toxic insult. Interestingly, other sox proteins also had the ability to reduce caspase-6 activity but to a lesser extent than sox11
26360498 BLIMP1 and XBP1 expression was also significantly more frequent in SOX11-negative than in -positive cases
25887497 The utility of mRNA analysis in defining SOX11 expression levels in mantle cell lymphoma and reactive lymph nodes.
25880212 Results show that in non-malignant cells, SOX11 is strongly marked by enrichment of H3K27me3 while tumors in general show promoter DNA methylation.
25804118 SOX4, SOX11, and PAX6 were significant for tumor type.
25801783 Our results indicate that aberrant SOX11 gene promoter methylation may underlie its down-regulation in Gastric cancer
25773392 SOX11 overexpression suppresses PCa cell migration and invasion. In conclusion, our findings demonstrate that SOX11 could suppress cell proliferation, migration, and invasion of PCa in vitro.
25766675 The results of this study suggest that differential miRNA expression in neurons could contribute to an altered function of the transcription factor SOX11 and other genes in the setting of epilepsy
25608839 These results suggest SOX11 as a possible biomarker that adds new biological information that could contribute to a better understanding of this pathology
More...

AA Sequence

MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQ      1 - 70
SPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEK     71 - 140
SAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGG    141 - 210
GGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPT    211 - 280
LSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSS    281 - 350
SGSSGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPE    351 - 420
LSEMIAGDWLEANFSDLVFTY                                                     421 - 441
//

Text Mined References (69)

PMID Year Title
26543203 2016 Deletions and de novo mutations of SOX11 are associated with a neurodevelopmental disorder with features of Coffin-Siris syndrome.
26505998 2015 Sox11 Reduces Caspase-6 Cleavage and Activity.
26360498 2015 Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype.
25887497 2015 The utility of mRNA analysis in defining SOX11 expression levels in mantle cell lymphoma and reactive lymph nodes.
25880212 2015 DNA methylation and histone modifications regulate SOX11 expression in lymphoid and solid cancer cells.
25804118 2015 SOX4, SOX11 and PAX6 mRNA expression was identified as a (prognostic) marker for the aggressiveness of neuroendocrine tumors of the lung by using next-generation expression analysis (NanoString).
25801783 2015 Aberrant SOX11 promoter methylation is associated with poor prognosis in gastric cancer.
25773392 2015 The role of tumor suppressor gene SOX11 in prostate cancer.
25766675 2015 SOX11 identified by target gene evaluation of miRNAs differentially expressed in focal and non-focal brain tissue of therapy-resistant epilepsy patients.
25608839 2015 SOX11 expression in chronic lymphocytic leukemia correlates with adverse prognostic markers.
More...