Property Summary

NCBI Gene PubMed Count 39
PubMed Score 69.92
PubTator Score 39.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 1.0e-02
atypical teratoid/rhabdoid tumor -1.300 2.5e-05
group 4 medulloblastoma -1.300 4.0e-04
interstitial cystitis 1.200 3.8e-03
invasive ductal carcinoma -1.200 4.4e-02
non-small cell lung cancer -1.627 9.1e-15

Gene RIF (26)

AA Sequence

MQRSPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLS      1 - 70
PAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAER     71 - 140
LRVQHLRDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPPQPPPEPFPAASGSARAFRELPPLGAEFDGL    141 - 210
GLPTPERSPLDGLEPGEAAFFPPPAAPEDCALRPFRAPYAPTELSRDPGGCYGAPLAEALRTAPPAAPLA    211 - 280
GLYYGTLGTPGPYPGPLSPPPEAPPLESAEPLGPAADLWADVDLTEFDQYLNCSRTRPDAPGLPYHVALA    281 - 350
KLGPRAMSCPEESSLISALSDASSAVYYSACISG                                        351 - 384
//

Text Mined References (40)

PMID Year Title