Property Summary

NCBI Gene PubMed Count 33
Grant Count 18
R01 Count 11
Funding $1,293,103.46
PubMed Score 66.30
PubTator Score 39.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
non-small cell lung cancer -1.627 0.000
interstitial cystitis 1.200 0.004
adult high grade glioma -1.100 0.010
atypical teratoid/rhabdoid tumor -1.300 0.000
group 4 medulloblastoma -1.300 0.000
invasive ductal carcinoma -1.200 0.044

Gene RIF (20)

PMID Text
26588701 GLI1 and GLI2, but not GLI3 are involved in the regulation of SOX18 gene expression in cervical carcinoma cell lines.
26573263 The downregulation of SOX18 was found to significantly inhibit cell adhesion and invasion.
26396173 NKD2 inhibits SOX18 and MMP-2,7,9 expression and suppresses BGC823 cell xenograft growth. NKD2 methylation may serve as a poor prognostic and chemo-sensitive marker in human gastric cancer. NKD2 impedes gastric cancer metastasis by inhibiting SOX18.
26151573 we demonstrated that upregulation of SOX18 was associated with a poor outcome in hepatocellular carcinoma patients
26148450 The genetic finding of a pathogenic SOX18 mutation enabled the diagnosis of the rare hypotrichosis-lymphedema-telangiectasia syndrome in our patient.
25310193 SOX18 may be involved in the progression of Non small cell lung cancer.
24697860 A new, autosomal dominant condition combining hypotrichosis-lymphedema-telangiectasia syndrome with renal defects is associated with a novel truncating mutation in the SOX18 gene.
24460943 SOX18wt has potent trans-activation proper- ties, while SOX18DN displayed dominant-negative effect.
24269235 The repression of Sox18 and its target genes may lead to altered formation of vessels in inflamed settings.
24065215 Data suggest that SOX18 transcription factor expression may serve as a marker for a poor prognosis in invasive ductal breast carcinoma.
More...

AA Sequence

MQRSPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLS      1 - 70
PAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAER     71 - 140
LRVQHLRDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPPQPPPEPFPAASGSARAFRELPPLGAEFDGL    141 - 210
GLPTPERSPLDGLEPGEAAFFPPPAAPEDCALRPFRAPYAPTELSRDPGGCYGAPLAEALRTAPPAAPLA    211 - 280
GLYYGTLGTPGPYPGPLSPPPEAPPLESAEPLGPAADLWADVDLTEFDQYLNCSRTRPDAPGLPYHVALA    281 - 350
KLGPRAMSCPEESSLISALSDASSAVYYSACISG                                        351 - 384
//

Text Mined References (34)

PMID Year Title
26588701 2015 SOX18 Is a Novel Target Gene of Hedgehog Signaling in Cervical Carcinoma Cell Lines.
26573263 2016 SOX18 knockdown suppresses the proliferation and metastasis, and induces the apoptosis of osteosarcoma cells.
26396173 2015 Silencing NKD2 by promoter region hypermethylation promotes gastric cancer invasion and metastasis by up-regulating SOX18 in human gastric cancer.
26151573 2015 Knockdown of SOX18 inhibits the proliferation, migration and invasion of hepatocellular carcinoma cells.
26148450 2016 Aortic Dilatation Associated With a De Novo Mutation in the SOX18 Gene: Expanding the Clinical Spectrum of Hypotrichosis-Lymphedema-Telangiectasia Syndrome.
25310193 2015 Prognostic significance of SOX18 expression in non-small cell lung cancer.
24697860 2015 Hypotrichosis-lymphedema-telangiectasia-renal defect associated with a truncating mutation in the SOX18 gene.
24460943 2013 Construction and functional analysis of novel dominant-negative mutant of human SOX18 protein.
24269235 2013 TNF?-induced down-regulation of Sox18 in endothelial cells is dependent on NF-?B.
24065215 2013 Impact of SOX18 expression in cancer cells and vessels on the outcome of invasive ductal breast carcinoma.
More...