Property Summary

NCBI Gene PubMed Count 56
Grant Count 57
R01 Count 41
Funding $5,587,833.19
PubMed Score 110.32
PubTator Score 60.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 GO Component (2)

Gene RIF (28)

PMID Text
26893351 SOX6 is a novel regulator of adipogenesis synergizing with epigenetic mechanisms.
26119940 The highly conserved high-mobility group (HMG) domain of SOX6 is required for SOX6-mediated p53 stabilization and tumor inhibitory activity.
25457384 SCF-mediated gamma-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation.
25023649 results suggest that miR-208 represents a potential onco-miR and participates in ESCC carcinogenesis by suppressing SOX6 expression
23731550 Findings provide evidence for the first time that SOX6 expression was decreased in hepatocellular carcinoma.
22547066 L-Sox5 and Sox6 proteins enhance chondrogenic miR-140 microRNA expression by strengthening dimeric Sox9 activity
21728837 SOX trio gene and protein decreased with advancement of osteoarthritis in human articular cartilage.
21625884 Genetic variants in the SOX6 gene are associated with bone mineral density in both Caucasian and Chinese populations
21263153 Sox6 enhances erythroid differentiation in human erythroid progenitors.
21262861 identified SOX5 and SOX6 as the first two SHOX-interacting proteins and have shown that this interaction regulates aggrecan expression, an essential factor in chondrogenesis and skeletal development.
More...

AA Sequence

MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWD      1 - 70
SVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLE     71 - 140
EMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGTPESLAEKERQLSTMITQLISLREQLLAAHD    141 - 210
EQKKLAASQIEKQRQQMDLARQQQEQIARQQQQLLQQQHKINLLQQQIQVQGHMPPLMIPIFPHDQRTLA    211 - 280
AAAAAQQGFLFPPGITYKPGDNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINQRLKGLSDRFGRNL    281 - 350
DTFEHGGGHSYNHKQIEQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEA    351 - 420
AAQPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALF    421 - 490
GDQDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNEKERTRFENLGPQLTGKSNED    491 - 560
GKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTGGATVAEARVYRDARGRASSEPHIKRPMNAFMV    561 - 630
WAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIV    631 - 700
DGKKLRIGEYKQLMRSRRQEMRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPE    701 - 770
PSLPVIQSTYGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN                771 - 828
//

Text Mined References (61)

PMID Year Title
26893351 2016 The transcription factor SOX6 contributes to the developmental origins of obesity by promoting adipogenesis.
26119940 2016 Role of p14ARF-HDM2-p53 axis in SOX6-mediated tumor suppression.
25457384 2015 SCF-mediated ?-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
25023649 2014 Mir-208 promotes cell proliferation by repressing SOX6 expression in human esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
More...