Property Summary

NCBI Gene PubMed Count 56
PubMed Score 110.32
PubTator Score 60.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 7.92637299514953E-26
periodontitis 269 1.70232681050768E-18
ovarian cancer 8492 3.31598294596361E-8
pilocytic astrocytoma 3086 1.21330312346966E-7
glioblastoma 5572 1.4146390059606E-4
pituitary cancer 1972 1.93954855969333E-4
invasive ductal carcinoma 2950 2.26425594502396E-4
nasopharyngeal carcinoma 1056 0.00112145819365349
medulloblastoma, large-cell 6234 0.0013984402052894
astrocytic glioma 2241 0.00156103699696037
Breast cancer 3099 0.00240981582216024
ductal carcinoma in situ 1745 0.00268553910767641
oligodendroglioma 2849 0.0039989611948889
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00529952122541861
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00615555921674805
subependymal giant cell astrocytoma 2287 0.0072909386281195
pediatric high grade glioma 2712 0.0145595805475898
osteosarcoma 7933 0.0243172021332523
medulloblastoma 1524 0.0399332441466494
ependymoma 2514 0.0492064197666992
mucosa-associated lymphoid tissue lymphoma 480 0.0494663678073258
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 1.0
Obesity 616 0.0 2.0
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Campomelic dysplasia 7 3.638 1.8
Hemoglobinopathy 2 3.328 1.7

Expression

  Differential Expression (21)

Synonym

Accession P35712 Q86VX7 Q9BXQ3 Q9BXQ4 Q9BXQ5 Q9H0I8
Symbols SOXD
HSSOX6

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GO Component (2)

Gene RIF (28)

PMID Text
26893351 SOX6 is a novel regulator of adipogenesis synergizing with epigenetic mechanisms.
26119940 The highly conserved high-mobility group (HMG) domain of SOX6 is required for SOX6-mediated p53 stabilization and tumor inhibitory activity.
25457384 SCF-mediated gamma-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation.
25023649 results suggest that miR-208 represents a potential onco-miR and participates in ESCC carcinogenesis by suppressing SOX6 expression
23731550 Findings provide evidence for the first time that SOX6 expression was decreased in hepatocellular carcinoma.
22547066 L-Sox5 and Sox6 proteins enhance chondrogenic miR-140 microRNA expression by strengthening dimeric Sox9 activity
21728837 SOX trio gene and protein decreased with advancement of osteoarthritis in human articular cartilage.
21625884 Genetic variants in the SOX6 gene are associated with bone mineral density in both Caucasian and Chinese populations
21263153 Sox6 enhances erythroid differentiation in human erythroid progenitors.
21262861 identified SOX5 and SOX6 as the first two SHOX-interacting proteins and have shown that this interaction regulates aggrecan expression, an essential factor in chondrogenesis and skeletal development.
More...

AA Sequence

MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWD      1 - 70
SVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLE     71 - 140
EMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGTPESLAEKERQLSTMITQLISLREQLLAAHD    141 - 210
EQKKLAASQIEKQRQQMDLARQQQEQIARQQQQLLQQQHKINLLQQQIQVQGHMPPLMIPIFPHDQRTLA    211 - 280
AAAAAQQGFLFPPGITYKPGDNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINQRLKGLSDRFGRNL    281 - 350
DTFEHGGGHSYNHKQIEQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEA    351 - 420
AAQPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALF    421 - 490
GDQDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNEKERTRFENLGPQLTGKSNED    491 - 560
GKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTGGATVAEARVYRDARGRASSEPHIKRPMNAFMV    561 - 630
WAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIV    631 - 700
DGKKLRIGEYKQLMRSRRQEMRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPE    701 - 770
PSLPVIQSTYGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN                771 - 828
//

Text Mined References (61)

PMID Year Title
26893351 2016 The transcription factor SOX6 contributes to the developmental origins of obesity by promoting adipogenesis.
26119940 2016 Role of p14ARF-HDM2-p53 axis in SOX6-mediated tumor suppression.
25457384 2015 SCF-mediated ?-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
25023649 2014 Mir-208 promotes cell proliferation by repressing SOX6 expression in human esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
More...