Property Summary

NCBI Gene PubMed Count 60
PubMed Score 118.42
PubTator Score 60.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.200 3.9e-03
astrocytic glioma 1.800 1.6e-03
Astrocytoma, Pilocytic 1.600 1.8e-06
Breast cancer -1.400 2.4e-03
ductal carcinoma in situ -1.700 2.7e-03
ependymoma 1.400 4.9e-02
glioblastoma 1.600 1.1e-04
intraductal papillary-mucinous carcinoma... -1.900 6.2e-03
intraductal papillary-mucinous neoplasm ... -1.900 6.3e-03
invasive ductal carcinoma -1.100 5.4e-04
medulloblastoma -1.600 4.0e-02
medulloblastoma, large-cell 1.800 1.4e-03
mucosa-associated lymphoid tissue lympho... 1.317 4.9e-02
nasopharyngeal carcinoma 1.800 1.1e-03
oligodendroglioma 2.000 4.0e-03
osteosarcoma -1.775 4.2e-03
ovarian cancer -2.400 1.1e-09
periodontitis -1.200 1.7e-18
pituitary cancer 1.400 1.9e-04
psoriasis -1.300 7.9e-26
subependymal giant cell astrocytoma 1.698 7.3e-03

 GO Component (2)

Gene RIF (32)

AA Sequence

MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWD      1 - 70
SVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLE     71 - 140
EMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGTPESLAEKERQLSTMITQLISLREQLLAAHD    141 - 210
EQKKLAASQIEKQRQQMDLARQQQEQIARQQQQLLQQQHKINLLQQQIQVQGHMPPLMIPIFPHDQRTLA    211 - 280
AAAAAQQGFLFPPGITYKPGDNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINQRLKGLSDRFGRNL    281 - 350
DTFEHGGGHSYNHKQIEQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEA    351 - 420
AAQPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALF    421 - 490
GDQDTVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNEKERTRFENLGPQLTGKSNED    491 - 560
GKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTGGATVAEARVYRDARGRASSEPHIKRPMNAFMV    561 - 630
WAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIV    631 - 700
DGKKLRIGEYKQLMRSRRQEMRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPE    701 - 770
PSLPVIQSTYGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN                771 - 828
//

Text Mined References (65)

PMID Year Title