Property Summary

NCBI Gene PubMed Count 57
Grant Count 44
R01 Count 28
Funding $2,796,964.85
PubMed Score 93.28
PubTator Score 60.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (33)

PMID Text
26927636 SOX5 has a strong inhibitory effect on MITF expression and seems to have a decisive clinical impact on melanoma during tumor progression.
26115875 The results of the present study suggest a role for SOX5 in the molecular pathogenesis of FL.
25572815 Our results indicate for the first time that SOX5 is a novel regulator of epithelial-mesenchymal transition in hepatocellular carcinoma
25305447 High Sox5 expression is associated with pituitary tumor.
25304615 Sox5-PAX5 fusion transcript is associated with B-cell precursor acute lymphoblastic leukemia.
25101494 Sox5 and Sox9 cause a significant increase in transactivation of the Catsper1 promoter.
24945754 These findings describe for the first time a functional role of SOX5 during late B cell development reducing the proliferative capacity and thus potentially affecting the differentiation of B cells.
24945754 Identified two new splice variants of SOX5 in human B cells, encoding the known L-SOX5B isoform and a new shorter isoform L-SOX5F. SOX5 limits the proliferative capacity of human primary B lymphocytes and potentially affects the differentiation of human B cells during the germinal center responses.
24648396 detection of SOX5 polymorphism in nonobstructive azoospermia contributing to predicting males at high risk of disease in Han Chinese population
24607904 depletion of Sox5 in breast cancer cells caused a dramatic decrease in Twist1 and chromosome immunoprecipitation assay showed that Sox5 can bind directly to the Twist1 promoter, suggesting that Sox5 transactivates Twist1 expression
More...

AA Sequence

MLTDPDLPQEFERMSSKRPASPYGEADGEVAMVTSRQKVEEEESDGLPAFHLPLHVSFPNKPHSEEFQPV      1 - 70
SLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSSTSPQKAEEGGRQSGESLSSTALGTPERRKGSLA     71 - 140
DVVDTLKQRKMEELIKNEPEETPSIEKLLSKDWKDKLLAMGSGNFGEIKGTPESLAEKERQLMGMINQLT    141 - 210
SLREQLLAAHDEQKKLAASQIEKQRQQMELAKQQQEQIARQQQQLLQQQHKINLLQQQIQVQGQLPPLMI    211 - 280
PVFPPDQRTLAAAAQQGFLLPPGFSYKAGCSDPYPVQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAAMQ    281 - 350
VSPGGKLPGIPQGNLGAAVSPTSIHTDKSTNSPPPKSKDEVAQPLNLSAKPKTSDGKSPTSPTSPHMPAL    351 - 420
RINSGAGPLKASVPAALASPSARVSTIGYLNDHDAVTKAIQEARQMKEQLRREQQVLDGKVAVVNSLGLN    421 - 490
NCRTEKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLSGDSDGSAGVSESRIYRESRGRGSNEPHIKRPM    491 - 560
NAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPK    561 - 630
RTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVGQQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSS    631 - 700
SPEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYGSDSENHIAGQAN           701 - 763
//

Text Mined References (63)

PMID Year Title
26927636 2016 SOX5 is involved in balanced MITF regulation in human melanoma cells.
26115875 2015 Identification of the SOX5 gene as a novel IGH-involved translocation partner in BCL2-negative follicular lymphoma with t(12;14)(p12.2;q32).
26111154 2015 Exome sequencing expands the mechanism of SOX5-associated intellectual disability: A case presentation with review of sox-related disorders.
25572815 2015 SOX5 promotes epithelial-mesenchymal transition and cell invasion via regulation of Twist1 in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25305447 2015 MiR-132, miR-15a and miR-16 synergistically inhibit pituitary tumor cell proliferation, invasion and migration by targeting Sox5.
25304615 2015 Three novel fusion transcripts of the paired box 5 gene in B-cell precursor acute lymphoblastic leukemia.
25101494 2014 The transcription factors Sox5 and Sox9 regulate Catsper1 gene expression.
24945754 2014 High levels of SOX5 decrease proliferative capacity of human B cells, but permit plasmablast differentiation.
24648396 2014 Association study between polymorphisms of PRMT6, PEX10, SOX5, and nonobstructive azoospermia in the Han Chinese population.
More...