Property Summary

NCBI Gene PubMed Count 57
PubMed Score 93.28
PubTator Score 60.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
non-small cell lung carcinoma 413 7.11382164132991E-25
psoriasis 6685 9.14828988178618E-13
posterior fossa group B ependymoma 1530 7.72357714269895E-10
pituitary cancer 1972 4.07318955212336E-7
Pick disease 1893 1.0954429836487E-6
ductal carcinoma in situ 1745 1.78937399894341E-4
invasive ductal carcinoma 2950 6.66770186295403E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00154510512353792
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0029135957434859
medulloblastoma, large-cell 6234 0.00411561045564849
interstitial cystitis 2299 0.00648733756252932
ovarian cancer 8492 0.00910229323908056
medulloblastoma 1524 0.0151592488091222
Alzheimer's disease 644 0.0269753054226878
lung cancer 4473 0.0333227954084983
osteosarcoma 7933 0.04870070007596
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Systemic scleroderma 66 0.0 2.0
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Campomelic dysplasia 7 3.725 1.9
Azoospermia 89 3.188 1.6
Disease Target Count
Lamb-Shaffer syndrome 1

Expression

  Differential Expression (16)

Synonym

Accession P35711 B7Z8V0 F5H5B0 Q86UK8 Q8J017 Q8J018 Q8J019 Q8J020 Q8N1D9 Q8N7E0 Q8TEA4
Symbols L-SOX5
LAMSHF
L-SOX5B
L-SOX5F

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (33)

PMID Text
26927636 SOX5 has a strong inhibitory effect on MITF expression and seems to have a decisive clinical impact on melanoma during tumor progression.
26115875 The results of the present study suggest a role for SOX5 in the molecular pathogenesis of FL.
25572815 Our results indicate for the first time that SOX5 is a novel regulator of epithelial-mesenchymal transition in hepatocellular carcinoma
25305447 High Sox5 expression is associated with pituitary tumor.
25304615 Sox5-PAX5 fusion transcript is associated with B-cell precursor acute lymphoblastic leukemia.
25101494 Sox5 and Sox9 cause a significant increase in transactivation of the Catsper1 promoter.
24945754 These findings describe for the first time a functional role of SOX5 during late B cell development reducing the proliferative capacity and thus potentially affecting the differentiation of B cells.
24945754 Identified two new splice variants of SOX5 in human B cells, encoding the known L-SOX5B isoform and a new shorter isoform L-SOX5F. SOX5 limits the proliferative capacity of human primary B lymphocytes and potentially affects the differentiation of human B cells during the germinal center responses.
24648396 detection of SOX5 polymorphism in nonobstructive azoospermia contributing to predicting males at high risk of disease in Han Chinese population
24607904 depletion of Sox5 in breast cancer cells caused a dramatic decrease in Twist1 and chromosome immunoprecipitation assay showed that Sox5 can bind directly to the Twist1 promoter, suggesting that Sox5 transactivates Twist1 expression
More...

AA Sequence

MLTDPDLPQEFERMSSKRPASPYGEADGEVAMVTSRQKVEEEESDGLPAFHLPLHVSFPNKPHSEEFQPV      1 - 70
SLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSSTSPQKAEEGGRQSGESLSSTALGTPERRKGSLA     71 - 140
DVVDTLKQRKMEELIKNEPEETPSIEKLLSKDWKDKLLAMGSGNFGEIKGTPESLAEKERQLMGMINQLT    141 - 210
SLREQLLAAHDEQKKLAASQIEKQRQQMELAKQQQEQIARQQQQLLQQQHKINLLQQQIQVQGQLPPLMI    211 - 280
PVFPPDQRTLAAAAQQGFLLPPGFSYKAGCSDPYPVQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAAMQ    281 - 350
VSPGGKLPGIPQGNLGAAVSPTSIHTDKSTNSPPPKSKDEVAQPLNLSAKPKTSDGKSPTSPTSPHMPAL    351 - 420
RINSGAGPLKASVPAALASPSARVSTIGYLNDHDAVTKAIQEARQMKEQLRREQQVLDGKVAVVNSLGLN    421 - 490
NCRTEKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLSGDSDGSAGVSESRIYRESRGRGSNEPHIKRPM    491 - 560
NAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPK    561 - 630
RTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVGQQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSS    631 - 700
SPEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYGSDSENHIAGQAN           701 - 763
//

Text Mined References (63)

PMID Year Title
26927636 2016 SOX5 is involved in balanced MITF regulation in human melanoma cells.
26115875 2015 Identification of the SOX5 gene as a novel IGH-involved translocation partner in BCL2-negative follicular lymphoma with t(12;14)(p12.2;q32).
26111154 2015 Exome sequencing expands the mechanism of SOX5-associated intellectual disability: A case presentation with review of sox-related disorders.
25572815 2015 SOX5 promotes epithelial-mesenchymal transition and cell invasion via regulation of Twist1 in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25305447 2015 MiR-132, miR-15a and miR-16 synergistically inhibit pituitary tumor cell proliferation, invasion and migration by targeting Sox5.
25304615 2015 Three novel fusion transcripts of the paired box 5 gene in B-cell precursor acute lymphoblastic leukemia.
25101494 2014 The transcription factors Sox5 and Sox9 regulate Catsper1 gene expression.
24945754 2014 High levels of SOX5 decrease proliferative capacity of human B cells, but permit plasmablast differentiation.
24648396 2014 Association study between polymorphisms of PRMT6, PEX10, SOX5, and nonobstructive azoospermia in the Han Chinese population.
More...