Property Summary

NCBI Gene PubMed Count 201
Grant Count 44
R01 Count 32
Funding $4,393,036.8
PubMed Score 381.86
PubTator Score 385.95

Knowledge Summary

Patent

No data available

Gene RIF (190)

PMID Text
26945423 Early-stage ovarian clear cell carcinoma tended to have high levels of HNF-1beta immunoreactivity. Low-level HNF-1beta expression was observed in patients with recurrence and high-level HNF-1beta was associated with good prognosis.
26339401 Combining HNF-1beta and napsin A may distinguish clear cell carcinoma from high-grade serous carcinoma, endometrioid adenocarcinoma and metastatic Krukenberg tumors.
26329304 The binding of has-miRNAs 214-5p and 550a-5p regulate the expression of the HNF1B gene and the susceptibility of type 2 diabetes mellitus.
26311117 HNF-1B-positive malignant cells could be bipotential cells and give rise to both hepatocytic and cholangiocytic lineages during tumorigenesis.
26214421 Meta-analysis of the association between the HNF1B rs4430796 (A>G) polymorphism and risk of prostate cancer based on case-control studies.
26030369 Studied upstream and downstream regulatory factors of HNF-1beta in ovarian clear cell carcinomas.
26022541 HNF1B score was discriminatory for HNF1B mutations in a large cohort of individuals tested in a single UK centre
25885815 rs4430796 polymorphism of HNF1B gene influences independently the prognosis of EC patients with a potential effect on tumor chemo-sensitivity.
25884453 In cervical carcinoma, expression of HNF-1beta is mostly restricted to adenocarcinomas and can be used as an auxiliary adenocarcinoma marker in the differential diagnosis of poorly differentiated cervical carcinomas.
25741167 Case Report: severe hepatic phenotype of an HNF1B variant.
More...

AA Sequence

MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHA      1 - 70
KGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVV     71 - 140
DVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFS    141 - 210
QQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSP    211 - 280
SKAHGLGSNLVTEVRVYNWFANRRKEEAFRQKLAMDAYSSNQTHSLNPLLSHGSPHHQPSSSPPNKLSGV    281 - 350
RYSQQGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMISVSGGGLPPVSTLTNIH    351 - 420
SLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPVINSVAGSLAALQPVQFSQQLHSPHQQPLMQQS    421 - 490
PGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSISTLTNMSSSKQCPLQAW       491 - 557
//

Text Mined References (209)

PMID Year Title
26945423 2016 Clinicopathologic Significance of HNF-1?, AIRD1A, and PIK3CA Expression in Ovarian Clear Cell Carcinoma: A Tissue Microarray Study of 130 Cases.
26339401 2015 Diagnostic value of dual detection of hepatocyte nuclear factor 1 beta (HNF-1?) and napsin A for diagnosing ovarian clear cell carcinoma.
26329304 2015 Polymorphism in microRNA-binding site in HNF1B influences the susceptibility of type 2 diabetes mellitus: a population based case-control study.
26311117 2015 Overexpression Of Hepatocyte Nuclear Factor-1beta Predicting Poor Prognosis Is Associated With Biliary Phenotype In Patients With Hepatocellular Carcinoma.
26214421 2015 Meta-analysis of the association between the HNF1B rs4430796 (A>G) polymorphism and risk of prostate cancer based on case-control studies.
26030369 2015 Transcriptional upregulation of HNF-1? by NF-?B in ovarian clear cell carcinoma modulates susceptibility to apoptosis through alteration in bcl-2 expression.
26022541 2015 Assessment of the HNF1B Score as a Tool to Select Patients for HNF1B Genetic Testing.
25885815 2015 HNF1B polymorphism influences the prognosis of endometrial cancer patients: a cohort study.
25884453 2015 Expression of HNF-1? in cervical carcinomas: an immunohistochemical study of 155 cases.
25741167 2015 Hepatic phenotypes of HNF1B gene mutations: a case of neonatal cholestasis requiring portoenterostomy and literature review.
More...