Property Summary

NCBI Gene PubMed Count 201
PubMed Score 381.86
PubTator Score 385.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 1.50390469017317E-25
osteosarcoma 7933 7.28474533821129E-7
psoriasis 6685 8.48438781839323E-5
medulloblastoma, large-cell 6234 2.23435191497643E-4
lung cancer 4473 0.0148732705466367
Disease Target Count Z-score Confidence
diabetes mellitus 1663 4.69 2.3

Synonym

Accession P35680 B4DKM3 E0YMJ9 HNF-1-beta
Symbols FJHN
HNF2
LFB3
TCF2
HPC11
LF-B3
MODY5
TCF-2
VHNF1
HNF-1B
HNF1beta
HNF-1-beta

Gene

PANTHER Protein Class (1)

PDB

2DA6   2H8R  

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (190)

PMID Text
26945423 Early-stage ovarian clear cell carcinoma tended to have high levels of HNF-1beta immunoreactivity. Low-level HNF-1beta expression was observed in patients with recurrence and high-level HNF-1beta was associated with good prognosis.
26339401 Combining HNF-1beta and napsin A may distinguish clear cell carcinoma from high-grade serous carcinoma, endometrioid adenocarcinoma and metastatic Krukenberg tumors.
26329304 The binding of has-miRNAs 214-5p and 550a-5p regulate the expression of the HNF1B gene and the susceptibility of type 2 diabetes mellitus.
26311117 HNF-1B-positive malignant cells could be bipotential cells and give rise to both hepatocytic and cholangiocytic lineages during tumorigenesis.
26214421 Meta-analysis of the association between the HNF1B rs4430796 (A>G) polymorphism and risk of prostate cancer based on case-control studies.
26030369 Studied upstream and downstream regulatory factors of HNF-1beta in ovarian clear cell carcinomas.
26022541 HNF1B score was discriminatory for HNF1B mutations in a large cohort of individuals tested in a single UK centre
25885815 rs4430796 polymorphism of HNF1B gene influences independently the prognosis of EC patients with a potential effect on tumor chemo-sensitivity.
25884453 In cervical carcinoma, expression of HNF-1beta is mostly restricted to adenocarcinomas and can be used as an auxiliary adenocarcinoma marker in the differential diagnosis of poorly differentiated cervical carcinomas.
25741167 Case Report: severe hepatic phenotype of an HNF1B variant.
More...

AA Sequence

MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHA      1 - 70
KGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVV     71 - 140
DVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFS    141 - 210
QQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSP    211 - 280
SKAHGLGSNLVTEVRVYNWFANRRKEEAFRQKLAMDAYSSNQTHSLNPLLSHGSPHHQPSSSPPNKLSGV    281 - 350
RYSQQGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMISVSGGGLPPVSTLTNIH    351 - 420
SLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPVINSVAGSLAALQPVQFSQQLHSPHQQPLMQQS    421 - 490
PGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSISTLTNMSSSKQCPLQAW       491 - 557
//

Text Mined References (209)

PMID Year Title
26945423 2016 Clinicopathologic Significance of HNF-1?, AIRD1A, and PIK3CA Expression in Ovarian Clear Cell Carcinoma: A Tissue Microarray Study of 130 Cases.
26339401 2015 Diagnostic value of dual detection of hepatocyte nuclear factor 1 beta (HNF-1?) and napsin A for diagnosing ovarian clear cell carcinoma.
26329304 2015 Polymorphism in microRNA-binding site in HNF1B influences the susceptibility of type 2 diabetes mellitus: a population based case-control study.
26311117 2015 Overexpression Of Hepatocyte Nuclear Factor-1beta Predicting Poor Prognosis Is Associated With Biliary Phenotype In Patients With Hepatocellular Carcinoma.
26214421 2015 Meta-analysis of the association between the HNF1B rs4430796 (A>G) polymorphism and risk of prostate cancer based on case-control studies.
26030369 2015 Transcriptional upregulation of HNF-1? by NF-?B in ovarian clear cell carcinoma modulates susceptibility to apoptosis through alteration in bcl-2 expression.
26022541 2015 Assessment of the HNF1B Score as a Tool to Select Patients for HNF1B Genetic Testing.
25885815 2015 HNF1B polymorphism influences the prognosis of endometrial cancer patients: a cohort study.
25884453 2015 Expression of HNF-1? in cervical carcinomas: an immunohistochemical study of 155 cases.
25741167 2015 Hepatic phenotypes of HNF1B gene mutations: a case of neonatal cholestasis requiring portoenterostomy and literature review.
More...