Property Summary

NCBI Gene PubMed Count 8
PubMed Score 143.02
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Synonym

Accession P35663 A0AVQ8 Q5JQQ9
Symbols CYCL1

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
19679225 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLPRLLKVNIRTYDNSIPISESSRKSWNQKHFALTFPKPLQRGTNDKSRPLKSQITVTRHDKRKLEEGQ      1 - 70
KPAHKWIRHSFRKILQWPPIYTAAREQTPFRHLYTSKTHLKKAEYKKSKDEKGGTPLKKDSKKKGGSYAT     71 - 140
NPESKQIVEEKTKRQNEADKTPLKSSHENEQSKKSKSSSETNPESQNSKTVSKNCSQKDKKDSKNSKKTN    141 - 210
TEFLHTKNNPKKDLKRSKTSNDPISEICSENSLNVDFLMLVGQSDDESINFDAWLRNYSQNNSKNYSLKY    211 - 280
TKYTKKDTKKNAKKSSDAESEDSKDAKKDSKKVKKNVKKDDKKKDVKKDTESTDAESGDSKDERKDTKKD    281 - 350
KKKLKKDDKKKDTKKYPESTDTESGDAKDARNDSRNLKKASKNDDKKKDAKKITFSTDSESELESKESQK    351 - 420
DEKKDKKDSKTDNKKSVKNDEESTDADSEPKGDSKKGKKDEKKGKKDSKKDDKKKDAKKNAESTEMESDL    421 - 490
ELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKPGAKKKIDE    491 - 560
SDGTSANSKMEGLESKRGFRMSSKKTTFNEKGEKASTGRVPPSREKPPLPACEPSLPSPKVRRLCWCKMP    561 - 630
PPPPKPRYAPLPEAPWIHKLL                                                     631 - 651
//

Text Mined References (8)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
19679225 2009 X chromosomal variation is associated with slow progression to AIDS in HIV-1-infected women.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12509440 2003 Phosphoproteome analysis of capacitated human sperm. Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8354692 1993 Molecular characterization of mammalian cylicin, a basic protein of the sperm head cytoskeleton.
7737358 1995 The protein complexity of the cytoskeleton of bovine and human sperm heads: the identification and characterization of cylicin II.