Property Summary

NCBI Gene PubMed Count 105
PubMed Score 193.23
PubTator Score 182.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 2.2e-04
Breast cancer 2.000 3.0e-02
dermatomyositis 1.500 5.6e-04
glioblastoma 1.100 1.2e-02
group 3 medulloblastoma 1.500 2.6e-03
medulloblastoma, large-cell 1.100 2.2e-03
pediatric high grade glioma 1.100 1.5e-04
primary Sjogren syndrome 1.300 1.9e-02
primitive neuroectodermal tumor 1.300 3.1e-04
Waldenstrons macroglobulinemia 2.852 2.8e-03

Gene RIF (74)

AA Sequence

MSASAPAAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEGKREKKKVERLTMQV      1 - 70
SSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTVSSLKKNVGQFSGFPFEKGSV     71 - 140
QYKKKEEMLKKFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNS    141 - 210
SGMARKAKRTKCPEILSDESSSDEDEKKNKEESSDDEDKESEEEPPKKTAKREKPKQKATSKSKKSVKSA    211 - 280
NVKKADSSTTKKNQNSSKKESESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKV    281 - 350
YENYPTYDLTERKDFIKTTVKELIS                                                 351 - 375
//

Text Mined References (119)

PMID Year Title