Property Summary

NCBI Gene PubMed Count 97
Grant Count 40
R01 Count 25
Funding $4,443,615.87
PubMed Score 173.66
PubTator Score 182.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (66)

PMID Text
26722432 miR-592 targets DEK transcript and suppresses hepatocellular carcinoma cell growth
26303528 The study identified the DEK oncoprotein as a critical factor that interacts with an essential upstream enhancer element of the EKLF promoter and exerts a positive effect on EKLF levels.
25524609 The results show that several leukemia-associated fusion genes cause an increase in DEK protein expression.
25515240 These data suggest DEK overexpression as a crucial event for the emergence of an aggressive phenotype in colorectal cancer.
25347734 Data show that oncoprotein DEK facilitates cellular proliferation under conditions of DNA replication stress by promoting replication fork progression.
25340858 DEK promotes the growth of colorectal cancer and apoptosis
25216995 Results find that DEK binds to transcription start sites with a dual role in activation and repression of highly and ubiquitously expressed genes.
25197373 DEK plays an important role in the progression of small cell lung cancer
25128083 DEK expression during normal hematopoiesis did reveal a relationship with specific cell types implicating a distinct function during myeloid differentiation
25049225 Results highlight a novel function of DEK as a guardian of chromatin by restricting widespread histone access, and in particular by modulating differential H3.3 loading in specific chromatin areas.
More...

AA Sequence

MSASAPAAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEGKREKKKVERLTMQV      1 - 70
SSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTVSSLKKNVGQFSGFPFEKGSV     71 - 140
QYKKKEEMLKKFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNS    141 - 210
SGMARKAKRTKCPEILSDESSSDEDEKKNKEESSDDEDKESEEEPPKKTAKREKPKQKATSKSKKSVKSA    211 - 280
NVKKADSSTTKKNQNSSKKESESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKV    281 - 350
YENYPTYDLTERKDFIKTTVKELIS                                                 351 - 375
//

Text Mined References (110)

PMID Year Title
26722432 2015 MicroRNA-592 targets DEK oncogene and suppresses cell growth in the hepatocellular carcinoma cell line HepG2.
26303528 2015 The DEK Oncoprotein Is a Critical Component of the EKLF/KLF1 Enhancer in Erythroid Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25524609 2015 The DEK oncoprotein is upregulated by multiple leukemia-associated fusion genes.
25515240 2014 DEK is a potential marker for aggressive phenotype and irinotecan-based therapy response in metastatic colorectal cancer.
25347734 2015 The human oncoprotein and chromatin architectural factor DEK counteracts DNA replication stress.
25340858 2014 Mechanisms underlying cancer growth and apoptosis by DEK overexpression in colorectal cancer.
25216995 2014 The DEK oncoprotein binds to highly and ubiquitously expressed genes with a dual role in their transcriptional regulation.
25197373 2014 High expression of oncoprotein DEK predicts poor prognosis of small cell lung cancer.
25128083 2015 DEK oncogene expression during normal hematopoiesis and in Acute Myeloid Leukemia (AML).
More...